Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y71A12B_10
         (741 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17508687|ref|NP_493435.1| ribosomal Protein, Small subunit (2...   448   e-125
gi|39581465|emb|CAE67995.1| Hypothetical protein CBG13605 [Caeno...   429   e-119
gi|20139890|sp|Q90YR8|RS6_ICTPU 40S ribosomal protein S6 >gnl|BL...   291   1e-77
gi|50369269|gb|AAH75953.1| Unknown (protein for MGC:92237) [Dani...   290   2e-77
gi|3122817|sp|O01727|RS6_BRAFL 40S ribosomal protein S6 >gnl|BL_...   287   1e-76
gi|19571835|emb|CAD27733.1| S6 ribosomal protein [Paracentrotus ...   286   2e-76
gi|20381196|gb|AAH27620.1| Ribosomal protein S6 [Homo sapiens]        285   5e-76
gi|47214750|emb|CAG01285.1| unnamed protein product [Tetraodon n...   285   5e-76
gi|6677809|ref|NP_033122.1| ribosomal protein S6 [Mus musculus] ...   285   7e-76
gi|15342049|gb|AAH13296.1| Ribosomal protein S6 [Homo sapiens]        285   7e-76
gi|26389925|dbj|BAC25813.1| unnamed protein product [Mus musculus]    283   2e-75
gi|730667|sp|P39017|RS6_XENLA 40S ribosomal protein S6 >gnl|BL_O...   283   3e-75
gi|34785048|gb|AAH09427.2| RPS6 protein [Homo sapiens]                282   4e-75
gi|20139963|sp|Q9YGF2|RS6_ONCMY 40S ribosomal protein S6 >gnl|BL...   282   6e-75
gi|27735388|gb|AAH41281.1| Rps6-prov protein [Xenopus laevis]         282   6e-75
gi|45361031|ref|NP_989152.1| 40S ribosomal protein S6 [Xenopus t...   281   8e-75
gi|20139918|sp|Q9BMX5|RS6_APLCA 40S ribosomal protein S6 >gnl|BL...   281   1e-74
gi|6601470|gb|AAF18987.1| ribosomal protein S6 [Gallus gallus]        281   1e-74
gi|45382571|ref|NP_990556.1| ribosomal protein S6 [Gallus gallus...   280   2e-74
gi|337516|gb|AAA60288.1| ribosomal protein s6                         280   2e-74
gi|48105994|ref|XP_393043.1| similar to ribosomal protein S6 [Ap...   280   3e-74
gi|337514|gb|AAA60287.1| ribosomal protein S6                         278   1e-73
gi|38077865|ref|XP_356840.1| similar to 40S ribosomal protein S6...   276   3e-73
gi|17737290|ref|NP_511073.1| CG10944-PB [Drosophila melanogaster...   274   1e-72
gi|28630207|gb|AAN77890.1| ribosomal protein S6 [Scyliorhinus ca...   271   8e-72
gi|24640435|ref|NP_727212.1| CG10944-PC [Drosophila melanogaster...   271   8e-72
gi|44967397|gb|AAS49570.1| ribosomal protein S6 [Protopterus dol...   271   1e-71
gi|2500492|sp|Q94624|RS6_MANSE 40S ribosomal protein S6 >gnl|BL_...   271   1e-71
gi|20139899|sp|Q95V32|RS6_SPOFR 40S ribosomal protein S6 >gnl|BL...   270   2e-71
gi|225901|prf||1403252A ribosomal protein S6                          270   3e-71
gi|38082945|ref|XP_123189.2| similar to 40S ribosomal protein S6...   268   9e-71
gi|20885795|ref|XP_125109.1| similar to 40S ribosomal protein S6...   267   1e-70
gi|20139958|sp|Q9U761|RS6_AEDAE 40S ribosomal protein S6 >gnl|BL...   266   3e-70
gi|20139959|sp|Q9U762|RS6_AEDAL 40S ribosomal protein S6 >gnl|BL...   263   2e-69
gi|50258617|gb|EAL21304.1| hypothetical protein CNBD3580 [Crypto...   262   6e-69
gi|44967342|gb|AAS49569.1| ribosomal protein S6 [Latimeria chalu...   259   4e-68
gi|45360889|ref|NP_989120.1| 40S ribosomal protein S6 [Xenopus t...   259   4e-68
gi|29650192|gb|AAO88054.1| ribosomal protein S6 [Anopheles steph...   257   2e-67
gi|20139942|sp|Q9M3V8|RS6_ASPOF 40S ribosomal protein S6 >gnl|BL...   257   2e-67
gi|50556370|ref|XP_505593.1| hypothetical protein [Yarrowia lipo...   257   2e-67
gi|33772503|gb|AAQ54653.1| 40S ribosomal protein S6 [Oikopleura ...   257   2e-67
gi|29841438|gb|AAP06470.1| similar to GenBank Accession Number Z...   256   4e-67
gi|37991906|gb|AAR06352.1| ribosomal protein s6 RPS6-2 [Oryza sa...   255   6e-67
gi|9931636|gb|AAG02240.1| ribosomal protein s6 RPS6-2 [Zea mays]      254   1e-66
gi|7440313|pir||T04334 ribosomal protein S6.1, cytosolic - maize...   254   1e-66
gi|32418138|ref|XP_329547.1| hypothetical protein [Neurospora cr...   254   1e-66
gi|41019561|tpe|CAD89874.1| TPA: ribosomal protein S6 [Anopheles...   254   1e-66
gi|37779084|gb|AAP20202.1| S6 ribosomal protein [Pagrus major]        253   3e-66
gi|34906842|ref|NP_914768.1| putative 40S ribosomal protein S6 [...   252   5e-66
gi|15238142|ref|NP_196598.1| 40S ribosomal protein S6 (RPS6B) [A...   252   5e-66
gi|44662864|gb|AAS47511.1| ribosomal protein S6 [Glycine max]         252   5e-66
gi|31206069|ref|XP_311986.1| ENSANGP00000011100 [Anopheles gambi...   252   6e-66
gi|38090521|ref|XP_122042.2| similar to 40S ribosomal protein S6...   250   2e-65
gi|2224751|emb|CAA74381.1| ribosomal protein S6 [Arabidopsis tha...   250   2e-65
gi|38086535|ref|XP_125431.2| similar to 40S ribosomal protein S6...   250   2e-65
gi|23619351|ref|NP_705313.1| 40S ribosomal subunit protein S6, p...   249   3e-65
gi|15236042|ref|NP_194898.1| 40S ribosomal protein S6 (RPS6A) [A...   249   5e-65
gi|49067970|ref|XP_398274.1| hypothetical protein UM00659.1 [Ust...   246   4e-64
gi|23482704|gb|EAA18609.1| Ribosomal protein S6e, putative [Plas...   246   5e-64
gi|2462694|emb|CAA05029.1| Sr-rip-1 [Strongyloides ratti]             245   6e-64
gi|50411943|ref|XP_457091.1| unnamed protein product [Debaryomyc...   244   1e-63
gi|50289221|ref|XP_447041.1| unnamed protein product [Candida gl...   244   2e-63
gi|1151236|gb|AAB68209.1| Lpg18p                                      243   3e-63
gi|38105184|gb|EAA51641.1| hypothetical protein MG03236.4 [Magna...   243   4e-63
gi|6319658|ref|NP_009740.1| Protein component of the small (40S)...   242   7e-63
gi|46107502|ref|XP_380810.1| conserved hypothetical protein [Gib...   242   7e-63
gi|1173271|sp|P41798|RS6_KLUMA 40S RIBOSOMAL PROTEIN S6 (S10) >g...   242   7e-63
gi|50310043|ref|XP_455035.1| unnamed protein product [Kluyveromy...   241   1e-62
gi|45201293|ref|NP_986863.1| AGR197Cp [Eremothecium gossypii] >g...   240   2e-62
gi|49088586|ref|XP_406101.1| hypothetical protein AN1964.2 [Aspe...   240   2e-62
gi|2662469|gb|AAB88298.1| ribosomal protein S6 [Arabidopsis thal...   240   3e-62
gi|46811229|gb|AAT01908.1| 40S ribosomal protein S6 [Pseudopleur...   239   3e-62
gi|31415645|gb|AAP46142.1| ribosomal protein S6 [Brassica napus]      238   1e-61
gi|19115050|ref|NP_594138.1| 40S ribosomal protein S6 [Schizosac...   234   1e-60
gi|5921213|emb|CAB56419.1| ribosomal protein S6 [Crocodylus nilo...   234   1e-60
gi|15558812|emb|CAC69540.1| putative ribosomal protein s6 [Elaph...   233   2e-60
gi|19113745|ref|NP_592833.1| 40s ribosomal protein s6 [Schizosac...   233   2e-60
gi|46227971|gb|EAK88891.1| 40S ribosomal protein S6 [Cryptospori...   232   5e-60
gi|6448641|emb|CAB61268.1| putative ribosomal protein s6 [Trache...   232   5e-60
gi|24640437|ref|NP_727213.1| CG10944-PA [Drosophila melanogaster...   232   7e-60
gi|49203284|emb|CAD43214.1| putative 40S ribosomal protein S6 [K...   222   7e-57
gi|38048337|gb|AAR10071.1| similar to Drosophila melanogaster Rp...   219   5e-56
gi|46444722|gb|EAL03995.1| hypothetical protein CaO19.4660 [Cand...   214   2e-54
gi|3413170|emb|CAA09042.1| 40S ribosomal protein S6 [Cicer ariet...   209   5e-53
gi|32400997|gb|AAP80704.1| 40S ribosome protein S8 [Griffithsia ...   197   2e-49
gi|2350928|dbj|BAA21993.1| ribosomal protein S6 [Entamoeba histo...   186   4e-46
gi|29246372|gb|EAA37971.1| GLP_64_20707_19961 [Giardia lamblia A...   179   4e-44
gi|4388624|emb|CAB05860.1| ribosomal protein S6 [Strongylocentro...   173   3e-42
gi|7440310|pir||S26078 ribosomal protein S6, cytosolic - common ...   169   6e-41
gi|20139945|sp|Q9NE83|RS6_LEIMA 40S ribosomal protein S6 >gnl|BL...   168   1e-40
gi|7440311|pir||JE0265 S6 ribosomal protein - Leishmania infantum     168   1e-40
gi|2507328|sp|P29345|RS6_TOBAC 40S RIBOSOMAL PROTEIN S6               167   3e-40
gi|6094190|sp|O44012|RS6_LEIIN 40S RIBOSOMAL PROTEIN S6 >gnl|BL_...   166   4e-40
gi|158229|gb|AAB05983.1| sequence coding for an alternate protei...   165   8e-40
gi|29650199|gb|AAO88055.1| ribosomal protein S6 [Telmatoscopus s...   162   7e-39
gi|20022|emb|CAA48187.1| ribosomal protein S6 [Nicotiana tabacum]     157   2e-37
gi|13811978|ref|NP_113107.1| 40S ribosomal protein S6 [Guillardi...   149   5e-35
gi|1480022|dbj|BAA11393.1| putative ribosomal protein [Brassica ...   146   4e-34
gi|21724191|gb|AAM28345.1| RPS6 [Culicoides sonorensis]               143   4e-33
gi|12751055|gb|AAK07522.1| PNAS-20 [Homo sapiens]                     114   2e-24
gi|19173606|ref|NP_597409.1| 40S RIBOSOMAL PROTEIN S6 [Encephali...   110   2e-23
gi|34865969|ref|XP_345977.1| similar to ribosomal protein S6 [Ra...    88   2e-16
gi|6010012|emb|CAB56194.2| Ribosomal protein S6 [Cercopithecus a...    85   1e-15
gi|42656928|ref|XP_376327.1| hypothetical protein XP_376327 [Hom...    82   1e-14
gi|15678288|ref|NP_275403.1| ribosomal protein S6 [Methanothermo...    67   3e-10
gi|20094882|ref|NP_614729.1| Ribosomal protein S6E (S10) [Methan...    64   4e-09
gi|45549336|ref|NP_572418.2| CG11386-PA [Drosophila melanogaster...    61   3e-08
gi|48477663|ref|YP_023369.1| small subunit ribosomal protein S6E...    58   2e-07
gi|14521633|ref|NP_127109.1| SSU ribosomal protein S6E [Pyrococc...    57   3e-07
gi|14590508|ref|NP_142576.1| 30S ribosomal protein S6E [Pyrococc...    57   4e-07
gi|11498122|ref|NP_069347.1| SSU ribosomal protein S6E (rps6E) [...    56   7e-07
gi|16082513|ref|NP_393803.1| 30S ribosomal protein S6E [Thermopl...    56   9e-07
gi|48852211|ref|ZP_00306401.1| COG2125: Ribosomal protein S6E (S...    56   9e-07
gi|20140255|sp|Q9HLA6|RS6E_THEAC 30S ribosomal protein S6e >gnl|...    56   9e-07
gi|45358770|ref|NP_988327.1| Ribosomal protein S6e [Methanococcu...    55   2e-06
gi|13542106|ref|NP_111794.1| 30S ribosomal protein S6E [Thermopl...    54   3e-06
gi|18976860|ref|NP_578217.1| SSU ribosomal protein S6E [Pyrococc...    53   6e-06
gi|15669446|ref|NP_248256.1| SSU ribosomal protein S6E [Methanoc...    53   6e-06
gi|104271|pir||A40186 ribosomal protein S6 - clawed frog (fragme...    53   8e-06
gi|15791272|ref|NP_281096.1| 30S ribosomal protein S6E; Rps6e [H...    51   2e-05
gi|38077078|ref|XP_357320.1| similar to 40S ribosomal protein S6...    50   5e-05
gi|15897344|ref|NP_341949.1| SSU ribosomal protein S6E (rps6E) [...    48   2e-04
gi|20140151|sp|Q975N7|RS6E_SULTO 30S ribosomal protein S6e             47   5e-04
gi|15920585|ref|NP_376254.1| 141aa long hypothetical 30S ribosom...    47   5e-04
gi|14602024|ref|NP_148569.1| 30S ribosomal protein S6 [Aeropyrum...    46   7e-04
gi|38073515|ref|XP_357133.1| similar to 40S ribosomal protein S6...    45   0.002
gi|20090385|ref|NP_616460.1| ribosomal protein S6e [Methanosarci...    41   0.030
gi|18312675|ref|NP_559342.1| ribosomal protein S6 [Pyrobaculum a...    41   0.030
gi|21228564|ref|NP_634486.1| SSU ribosomal protein S6E [Methanos...    40   0.039
gi|38047803|gb|AAR09804.1| similar to Drosophila melanogaster Rp...    40   0.039
gi|41149852|ref|XP_372482.1| similar to 40S ribosomal protein S6...    40   0.066
gi|32410635|ref|XP_325798.1| hypothetical protein [Neurospora cr...    38   0.25
gi|31873103|emb|CAD98731.1| Hypothetical protein F32B4.4b [Caeno...    37   0.33
gi|17507059|ref|NP_492945.1| RNA-binding region RNP-1 (1M119) [C...    37   0.33
gi|41720214|ref|ZP_00149027.1| COG2125: Ribosomal protein S6E (S...    37   0.56
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna...    36   0.73
gi|23121552|ref|ZP_00103808.1| COG1020: Non-ribosomal peptide sy...    34   2.8
gi|15228908|ref|NP_188934.1| F-box family protein-related [Arabi...    34   2.8
gi|28558932|ref|NP_788192.1| RC205 [Ruegeria sp. PR1b] >gnl|BL_O...    34   3.6
gi|46432795|gb|EAK92262.1| hypothetical protein CaO19.5498 [Cand...    34   3.6
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays]                  34   3.6
gi|24308177|ref|NP_060439.1| hypothetical protein FLJ10006 [Homo...    34   3.6
gi|41054625|ref|NP_955870.1| splicing factor, arginine/serine-ri...    34   3.6
gi|41614902|ref|NP_963400.1| NEQ105 [Nanoarchaeum equitans Kin4-...    34   3.6
gi|48854997|ref|ZP_00309157.1| COG0855: Polyphosphate kinase [Cy...    34   3.6
gi|50550665|ref|XP_502805.1| hypothetical protein [Yarrowia lipo...    33   6.2
gi|49077402|ref|XP_402565.1| hypothetical protein UM04950.1 [Ust...    33   6.2
gi|45359070|ref|NP_988627.1| pyruvate oxidoreductase (synthase) ...    33   8.1
gi|9651770|gb|AAF91262.1| pyruvate oxidoreductase delta subunit ...    33   8.1
gi|860970|emb|CAA60698.1| HP8 peptide [Homo sapiens]                   33   8.1
gi|1082465|pir||S54834 HP8 peptide - human (fragment)                  33   8.1
gi|34853091|ref|XP_342392.1| inositol polyphosphate 5-phosphatas...    33   8.1
gi|21739669|emb|CAD38875.1| hypothetical protein [Homo sapiens]        33   8.1
gi|40806973|gb|AAH65279.1| FLJ10006 protein [Homo sapiens]             33   8.1
gi|23105132|ref|ZP_00091590.1| COG1186: Protein chain release fa...    33   8.1
gi|17553336|ref|NP_497176.1| ankyrin (3A811) [Caenorhabditis ele...    33   8.1


>gi|17508687|ref|NP_493435.1| ribosomal Protein, Small subunit (28.1
           kD) (rps-6) [Caenorhabditis elegans]
 gi|7320819|emb|CAB81996.1| Hypothetical protein Y71A12B.1
           [Caenorhabditis elegans]
          Length = 246

 Score =  448 bits (1152), Expect = e-125
 Identities = 225/225 (100%), Positives = 225/225 (100%)
 Frame = +1

Query: 1   MRLNFAYPATGLQKSFEVDEEKKLRLFFEKRMSQEVAIDALGDEWKGYVVRIGGGNDKQG 180
           MRLNFAYPATGLQKSFEVDEEKKLRLFFEKRMSQEVAIDALGDEWKGYVVRIGGGNDKQG
Sbjct: 1   MRLNFAYPATGLQKSFEVDEEKKLRLFFEKRMSQEVAIDALGDEWKGYVVRIGGGNDKQG 60

Query: 181 FPMKQGILTNGRVRLLLKKGQSCYRERKNGERKRKSVRGCIVDANMSALSLVIVKKGDGE 360
           FPMKQGILTNGRVRLLLKKGQSCYRERKNGERKRKSVRGCIVDANMSALSLVIVKKGDGE
Sbjct: 61  FPMKQGILTNGRVRLLLKKGQSCYRERKNGERKRKSVRGCIVDANMSALSLVIVKKGDGE 120

Query: 361 IEGLTDSVLPRKLGPKRASKIRKLFNLTKHDDVTKYVITHDKTFPDGVTKTIAPKIQRLI 540
           IEGLTDSVLPRKLGPKRASKIRKLFNLTKHDDVTKYVITHDKTFPDGVTKTIAPKIQRLI
Sbjct: 121 IEGLTDSVLPRKLGPKRASKIRKLFNLTKHDDVTKYVITHDKTFPDGVTKTIAPKIQRLI 180

Query: 541 TPARIARKKYLLRQKRNQKIKMRDDAAAYHKLLAKYSKEEHDAKI 675
           TPARIARKKYLLRQKRNQKIKMRDDAAAYHKLLAKYSKEEHDAKI
Sbjct: 181 TPARIARKKYLLRQKRNQKIKMRDDAAAYHKLLAKYSKEEHDAKI 225




[DB home][top]