Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y71G12B_22
         (357 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17510607|ref|NP_490896.1| cyclin-dependent kinases regulatory...   244   3e-64
gi|39586321|emb|CAE66732.1| Hypothetical protein CBG12081 [Caeno...   156   1e-37
gi|13384804|ref|NP_079691.1| CDC28 protein kinase regulatory sub...   107   7e-23
gi|4502859|ref|NP_001818.1| CDC28 protein kinase 2; CKS1(S. cere...   107   7e-23
gi|23392951|emb|CAD43044.1| cyclin dependant kinases regulatory ...   105   2e-22
gi|38077859|ref|XP_356838.1| similar to CYCLIN-DEPENDENT KINASES...   105   2e-22
gi|42362268|gb|AAS13367.1| cyclin-dependent kinases regulatory s...   105   2e-22
gi|2493726|sp|Q91879|CKS2_XENLA CYCLIN-DEPENDENT KINASES REGULAT...   105   2e-22
gi|12847359|dbj|BAB27540.1| unnamed protein product [Mus musculus]    105   3e-22
gi|50418152|gb|AAH77092.1| Unknown (protein for MGC:101026) [Dan...   105   3e-22
gi|45935118|gb|AAS79576.1| putative CDK regulatory subunit [Ipom...   104   4e-22
gi|47115197|emb|CAG28558.1| CKS2 [Homo sapiens]                       104   5e-22
gi|30585357|gb|AAP36951.1| Homo sapiens CDC28 protein kinase reg...   103   6e-22
gi|39588814|emb|CAE69444.1| Hypothetical protein CBG15632 [Caeno...   103   6e-22
gi|17539564|ref|NP_501457.1| cyclin-dependent kinase regulatory ...   103   6e-22
gi|47225594|emb|CAG07937.1| unnamed protein product [Tetraodon n...   103   6e-22
gi|4502857|ref|NP_001817.1| CDC28 protein kinase 1B; CDC2-associ...   103   6e-22
gi|50344876|ref|NP_001002110.1| zgc:86839 [Danio rerio] >gnl|BL_...   103   1e-21
gi|15226294|ref|NP_180363.1| cyclin-dependent kinase / CDK (CKS1...   103   1e-21
gi|17136850|ref|NP_476947.1| CG3738-PA [Drosophila melanogaster]...   102   1e-21
gi|15451612|gb|AAK98736.1| Putative cyclin-dependent kinase regu...   102   1e-21
gi|12835151|dbj|BAB23169.1| unnamed protein product [Mus musculu...   102   1e-21
gi|1168966|sp|P41384|CKS1_PATVU CYCLIN-DEPENDENT KINASES REGULAT...   101   3e-21
gi|27803876|gb|AAO22151.1| cyclin-dependent kinase regulatory su...   101   4e-21
gi|47219471|emb|CAG10835.1| unnamed protein product [Tetraodon n...   100   5e-21
gi|50405022|ref|YP_054114.1| Cyclin dependent kinase regulatory ...   100   7e-21
gi|2493727|sp|P55933|CKS1_PHYPO PROBABLE CYCLIN-DEPENDENT KINASE...   100   7e-21
gi|21355377|ref|NP_649817.1| CG9790-PA [Drosophila melanogaster]...   100   9e-21
gi|18158610|gb|AAK91295.2| CDC28 protein kinase 1-like protein [...   100   1e-20
gi|2493729|sp|Q25330|CKS1_LEIME CYCLIN-DEPENDENT KINASES REGULAT...    99   2e-20
gi|15226297|ref|NP_180364.1| cyclin-dependent kinase, putative /...    98   3e-20
gi|40641585|emb|CAE54272.1| putative cyclin-dependent kinase reg...    98   3e-20
gi|1310782|pdb|1SCE|A Chain A, Mol_id: 1; Molecule: Suc1; Chain:...    97   1e-19
gi|27435806|gb|AAO13226.1| CKS1 protein [Populus tremula x Popul...    95   3e-19
gi|31202809|ref|XP_310353.1| ENSANGP00000005592 [Anopheles gambi...    95   3e-19
gi|6319611|ref|NP_009693.1| subunit of the Cdc28 protein kinase;...    95   4e-19
gi|19112223|ref|NP_595431.1| cyclin-dependent kinases regulatory...    94   5e-19
gi|1421400|pdb|1PUC|  P13suc1 In A Strand-Exchanged Dimer              94   5e-19
gi|45185339|ref|NP_983056.1| ABR109Cp [Eremothecium gossypii] >g...    94   9e-19
gi|50285549|ref|XP_445203.1| unnamed protein product [Candida gl...    92   2e-18
gi|49073186|ref|XP_400825.1| hypothetical protein UM03210.1 [Ust...    92   2e-18
gi|20834536|ref|XP_123604.1| similar to Cyclin-dependent kinases...    92   3e-18
gi|3108169|gb|AAC15771.1| Cdc2 binding protein Suc1 [Pneumocysti...    91   4e-18
gi|50305891|ref|XP_452906.1| unnamed protein product [Kluyveromy...    91   6e-18
gi|50257471|gb|EAL20178.1| hypothetical protein CNBF2540 [Crypto...    90   9e-18
gi|38102152|gb|EAA49024.1| hypothetical protein MG00682.4 [Magna...    90   1e-17
gi|46120526|ref|XP_385086.1| hypothetical protein FG04910.1 [Gib...    89   2e-17
gi|32417582|ref|XP_329269.1| hypothetical protein [Neurospora cr...    89   3e-17
gi|46431885|gb|EAK91406.1| hypothetical protein CaO19.8869 [Cand...    88   4e-17
gi|506875|dbj|BAA01859.1| Cks1 protein [Saccharomyces cerevisiae]      87   6e-17
gi|50556364|ref|XP_505590.1| hypothetical protein [Yarrowia lipo...    87   6e-17
gi|49139562|ref|XP_413561.1| hypothetical protein AN9424.2 [Aspe...    87   6e-17
gi|50423397|ref|XP_460281.1| unnamed protein product [Debaryomyc...    86   1e-16
gi|50257317|gb|EAL20026.1| hypothetical protein CNBF3520 [Crypto...    85   4e-16
gi|29251447|gb|EAA42928.1| GLP_170_20046_20303 [Giardia lamblia ...    83   1e-15
gi|12751051|gb|AAK07520.1| PNAS-18 [Homo sapiens]                      80   7e-15
gi|31197815|ref|XP_307855.1| ENSANGP00000018659 [Anopheles gambi...    79   2e-14
gi|28829032|gb|AAO51607.1| similar to putative protein involved ...    68   5e-11
gi|23489948|gb|EAA21836.1| hypothetical protein [Plasmodium yoel...    39   0.025
gi|23613753|ref|NP_704774.1| hypothetical protein [Plasmodium fa...    39   0.033
gi|13277315|emb|CAC34416.1| putative TatC protein [Legionella pn...    33   1.4
gi|50547385|ref|XP_501162.1| hypothetical protein [Yarrowia lipo...    33   1.4
gi|50777728|ref|XP_423296.1| PREDICTED: similar to eukaryotic tr...    33   1.8
gi|21281872|ref|NP_644958.1| ORFID:MW0143~hypothetical protein, ...    33   1.8
gi|49482411|ref|YP_039635.1| putative cation efflux system prote...    33   1.8
gi|15923158|ref|NP_370692.1| hypothetical protein SAV0168 [Staph...    33   1.8
gi|47218381|emb|CAG01902.1| unnamed protein product [Tetraodon n...    32   2.3
gi|37528958|gb|AAQ92405.1| RhaD [Rhizobium leguminosarum bv. tri...    32   2.3
gi|32816585|gb|AAO39160.1| maturase K [Nitella opaca]                  32   4.0
gi|24212083|sp|Q9PU36|PCLO_CHICK Piccolo protein (Aczonin) >gnl|...    32   4.0
gi|46227505|gb|EAK88440.1| extracellular membrane associated pro...    31   5.2
gi|21230525|ref|NP_636442.1| type III restriction-modification e...    31   6.8
gi|47228312|emb|CAG07707.1| unnamed protein product [Tetraodon n...    31   6.8
gi|49130067|ref|XP_412949.1| hypothetical protein AN8812.2 [Aspe...    30   8.9
gi|48836099|ref|ZP_00293096.1| hypothetical protein Tfus02001280...    30   8.9


>gi|17510607|ref|NP_490896.1| cyclin-dependent kinases regulatory
           (14.3 kD) (1C270) [Caenorhabditis elegans]
 gi|14916415|gb|AAK73928.1| Hypothetical protein Y71G12B.27
           [Caenorhabditis elegans]
          Length = 118

 Score =  244 bits (623), Expect = 3e-64
 Identities = 118/118 (100%), Positives = 118/118 (100%)
 Frame = -1

Query: 357 MEDIYYSPRYEDDEYEYRHVILPQAVSRKVPKGRLLSEAEWRRAGVQQSLGWEHYMVHNP 178
           MEDIYYSPRYEDDEYEYRHVILPQAVSRKVPKGRLLSEAEWRRAGVQQSLGWEHYMVHNP
Sbjct: 1   MEDIYYSPRYEDDEYEYRHVILPQAVSRKVPKGRLLSEAEWRRAGVQQSLGWEHYMVHNP 60

Query: 177 EKHILLFRRKRHFTKADEERAKMELLRDMEVFNRAQQQTTATDEKLNAVFYEFVNKAV 4
           EKHILLFRRKRHFTKADEERAKMELLRDMEVFNRAQQQTTATDEKLNAVFYEFVNKAV
Sbjct: 61  EKHILLFRRKRHFTKADEERAKMELLRDMEVFNRAQQQTTATDEKLNAVFYEFVNKAV 118




[DB home][top]