Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y71G12B_9
(234 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17510579|ref|NP_490883.1| u6 snRNA-associated Sm-like protein... 156 1e-37
gi|39589389|emb|CAE74418.1| Hypothetical protein CBG22150 [Caeno... 155 2e-37
gi|5901998|ref|NP_009011.1| Sm protein F [Homo sapiens] >gnl|BL_... 134 7e-31
gi|50746299|ref|XP_420431.1| PREDICTED: similar to U6 snRNA-asso... 134 7e-31
gi|47217355|emb|CAG11060.1| unnamed protein product [Tetraodon n... 132 2e-30
gi|50344808|ref|NP_001002077.1| zgc:92379 [Danio rerio] >gnl|BL_... 132 3e-30
gi|48716974|dbj|BAD23667.1| putative Sm protein F [Oryza sativa ... 129 2e-29
gi|15224366|ref|NP_181909.1| small nuclear ribonucleoprotein F, ... 125 2e-28
gi|20861373|ref|XP_134104.1| RIKEN cDNA 2410088K19 [Mus musculus] 125 2e-28
gi|31212689|ref|XP_315329.1| ENSANGP00000021121 [Anopheles gambi... 125 3e-28
gi|15232179|ref|NP_191540.1| small nuclear ribonucleoprotein F, ... 124 4e-28
gi|21554327|gb|AAM63434.1| U6 snRNA-associated Sm-like protein [... 124 5e-28
gi|34851678|ref|XP_344755.1| similar to U6 snRNA-associated Sm-l... 123 1e-27
gi|34879731|ref|XP_344138.1| similar to U6 snRNA-associated Sm-l... 123 1e-27
gi|24656550|ref|NP_611528.1| CG9344-PA [Drosophila melanogaster]... 122 3e-27
gi|11602707|emb|CAC18540.1| putative U6-snRNA-associated protein... 120 8e-27
gi|19115292|ref|NP_594380.1| small nuclear ribonucleoprotein, F-... 110 1e-23
gi|46229796|gb|EAK90614.1| small nuclear ribonucleo protein [Cry... 102 3e-21
gi|49068436|ref|XP_398507.1| hypothetical protein UM00892.1 [Ust... 96 2e-19
gi|23619200|ref|NP_705162.1| u6 snRNA-associated sm-like protein... 95 3e-19
gi|50254570|gb|EAL17319.1| hypothetical protein CNBN1460 [Crypto... 93 2e-18
gi|28829666|gb|AAO52182.1| similar to Homo sapiens (Human). Sm p... 92 2e-18
gi|46107150|ref|XP_380634.1| hypothetical protein FG00458.1 [Gib... 92 3e-18
gi|23483747|gb|EAA19315.1| probable u6 snRNA-associated sm-like ... 90 1e-17
gi|38108971|gb|EAA54910.1| hypothetical protein MG05701.4 [Magna... 81 5e-15
gi|39645845|gb|AAH63397.1| Unknown (protein for IMAGE:5176590) [... 77 1e-13
gi|33876795|gb|AAH02505.2| SNRPF protein [Homo sapiens] 77 1e-13
gi|41946811|gb|AAH66015.1| Unknown (protein for IMAGE:5715059) [... 77 1e-13
gi|4507131|ref|NP_003086.1| small nuclear ribonucleoprotein poly... 77 1e-13
gi|48145619|emb|CAG33032.1| SNRPF [Homo sapiens] 77 1e-13
gi|50728518|ref|XP_416157.1| PREDICTED: similar to Small nuclear... 77 1e-13
gi|49619143|gb|AAT68156.1| small nuclear ribonucleoprotein F [Da... 77 1e-13
gi|34864945|ref|XP_345815.1| similar to Small nuclear ribonucleo... 76 2e-13
gi|38079111|ref|XP_357414.1| similar to SNRPF protein [Mus muscu... 76 2e-13
gi|15234669|ref|NP_194751.1| small nuclear ribonucleoprotein F, ... 75 3e-13
gi|50252055|dbj|BAD27986.1| putative small nuclear ribonucleopro... 75 3e-13
gi|50421459|ref|XP_459280.1| unnamed protein product [Debaryomyc... 75 5e-13
gi|47218337|emb|CAG04169.1| unnamed protein product [Tetraodon n... 74 8e-13
gi|31212897|ref|XP_312266.1| ENSANGP00000002801 [Anopheles gambi... 73 2e-12
gi|22024001|ref|NP_523708.2| CG16792-PA [Drosophila melanogaster... 71 7e-12
gi|495021|gb|AAA28445.1| membrane-associated protein 71 7e-12
gi|42415804|gb|AAS15770.1| DebB [Drosophila simulans] 71 7e-12
gi|50258571|gb|EAL21258.1| hypothetical protein CNBD3130 [Crypto... 70 1e-11
gi|50295347|ref|XP_444899.1| unnamed protein product [Candida gl... 69 2e-11
gi|17557029|ref|NP_498708.1| small nuclear ribonucleoprotein, sm... 69 2e-11
gi|39589637|emb|CAE66872.1| Hypothetical protein CBG12250 [Caeno... 68 6e-11
gi|27704896|ref|XP_230870.1| similar to Small nuclear ribonucleo... 67 1e-10
gi|50308123|ref|XP_454062.1| unnamed protein product [Kluyveromy... 66 2e-10
gi|50288725|ref|XP_446792.1| unnamed protein product [Candida gl... 66 2e-10
gi|19112893|ref|NP_596101.1| small nuclear ribonucleoprotein F [... 65 4e-10
gi|38076106|ref|XP_356732.1| similar to SNRPF protein [Mus muscu... 65 5e-10
gi|45185890|ref|NP_983606.1| ACR204Cp [Eremothecium gossypii] >g... 64 1e-09
gi|6320586|ref|NP_010666.1| Like Sm-F protein; Lsm6p [Saccharomy... 62 2e-09
gi|50543240|ref|XP_499786.1| hypothetical protein [Yarrowia lipo... 62 4e-09
gi|23508471|ref|NP_701140.1| small nuclear ribonucleoprotein F, ... 60 9e-09
gi|29726409|pdb|1LOJ|A Chain A, Crystal Structure Of A Methanoba... 59 2e-08
gi|50422347|ref|XP_459736.1| unnamed protein product [Debaryomyc... 59 2e-08
gi|15678676|ref|NP_275791.1| conserved protein [Methanothermobac... 59 2e-08
gi|29726339|pdb|1JBM|A Chain A, Heptameric Crystal Structure Of ... 59 2e-08
gi|20150503|pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-L... 59 2e-08
gi|13786869|pdb|1I81|A Chain A, Crystal Structure Of A Heptameri... 59 2e-08
gi|48838724|ref|ZP_00295664.1| COG1958: Small nuclear ribonucleo... 58 6e-08
gi|18312096|ref|NP_558763.1| small nuclear ribonucleoprotein hom... 58 6e-08
gi|27574150|pdb|1N9S|A Chain A, Crystal Structure Of Yeast Smf I... 57 8e-08
gi|41720360|ref|ZP_00149173.1| COG1958: Small nuclear ribonucleo... 57 1e-07
gi|6325440|ref|NP_015508.1| Sm or Sm-like snRNP protein; Smx3p [... 56 2e-07
gi|27574143|pdb|1N9R|A Chain A, Crystal Structure Of A Heptameri... 56 2e-07
gi|50308333|ref|XP_454168.1| unnamed protein product [Kluyveromy... 56 2e-07
gi|20092011|ref|NP_618086.1| Sm protein [Methanosarcina acetivor... 56 2e-07
gi|21226441|ref|NP_632363.1| putative snRNP Sm-like protein [Met... 55 3e-07
gi|46108998|ref|XP_381557.1| hypothetical protein FG01381.1 [Gib... 55 4e-07
gi|11498481|ref|NP_069709.1| snRNP, putative [Archaeoglobus fulg... 55 4e-07
gi|32415147|ref|XP_328053.1| hypothetical protein ( related to s... 55 4e-07
gi|38103439|gb|EAA50136.1| hypothetical protein MG03895.4 [Magna... 55 5e-07
gi|15897150|ref|NP_341755.1| Small nuclear riboprotein protein (... 54 9e-07
gi|16082245|ref|NP_394696.1| small nuclear ribonucleoprotein rel... 54 1e-06
gi|15920417|ref|NP_376086.1| 90aa long hypothetical small nuclea... 53 1e-06
gi|45190332|ref|NP_984586.1| AEL274Cp [Eremothecium gossypii] >g... 52 3e-06
gi|18977914|ref|NP_579271.1| small nuclear ribonucleoprotein, pu... 52 3e-06
gi|13541187|ref|NP_110875.1| Small nuclear ribonucleoprotein (sn... 51 6e-06
gi|14591301|ref|NP_143379.1| small nucleoprotein [Pyrococcus hor... 51 6e-06
gi|14324575|dbj|BAB59502.1| small nuclear ribonucleoprotein [The... 51 6e-06
gi|14277786|pdb|1I8F|A Chain A, The Crystal Structure Of A Hepta... 50 1e-05
gi|18312179|ref|NP_558846.1| small nuclear ribonucleoprotein hom... 50 1e-05
gi|28948591|pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii ... 50 1e-05
gi|14520857|ref|NP_126332.1| snRNP, putative [Pyrococcus abyssi ... 50 1e-05
gi|49110436|ref|XP_411743.1| hypothetical protein AN7606.2 [Aspe... 50 2e-05
gi|47207638|emb|CAF90891.1| unnamed protein product [Tetraodon n... 49 4e-05
gi|4507133|ref|NP_003087.1| small nuclear ribonucleoprotein poly... 48 6e-05
gi|9837170|gb|AAG00459.1| Sm-F [Trypanosoma brucei] 48 6e-05
gi|50260704|gb|EAL23354.1| hypothetical protein CNBA0080 [Crypto... 48 6e-05
gi|48852470|ref|ZP_00306656.1| COG1958: Small nuclear ribonucleo... 47 8e-05
gi|18860007|ref|NP_573139.1| CG9742-PA [Drosophila melanogaster]... 47 1e-04
gi|19074156|ref|NP_584762.1| SMALL NUCLEAR RIBONUCLEOPROTEIN F [... 46 2e-04
gi|13812032|ref|NP_113163.1| small nuclear ribonucleoprotein F [... 46 2e-04
gi|48477742|ref|YP_023448.1| snRNP Sm-like protein [Picrophilus ... 46 2e-04
gi|50545437|ref|XP_500256.1| hypothetical protein [Yarrowia lipo... 45 5e-04
gi|15920992|ref|NP_376661.1| 79aa long hypothetical small nuclea... 45 5e-04
gi|48852496|ref|ZP_00306682.1| COG1958: Small nuclear ribonucleo... 44 0.001
gi|19074364|ref|NP_585870.1| U6-snRNA ASSOCIATED SMALL NUCLEAR R... 44 0.001
gi|38080450|ref|XP_357495.1| similar to small nuclear ribonucleo... 43 0.002
gi|38344578|emb|CAE05536.2| OSJNBa0053B21.10 [Oryza sativa (japo... 43 0.002
gi|15897658|ref|NP_342263.1| Small nuclear riboprotein protein (... 43 0.002
gi|19113071|ref|NP_596279.1| putative small ribonuclear protein-... 43 0.002
gi|50259394|gb|EAL22067.1| hypothetical protein CNBC2050 [Crypto... 42 0.003
gi|34394185|dbj|BAC84637.1| putative small nuclear ribonucleopro... 42 0.003
gi|38099604|gb|EAA46929.1| hypothetical protein MG10740.4 [Magna... 42 0.003
gi|19113214|ref|NP_596422.1| small nuclear ribonucleoprotein [Sc... 42 0.003
gi|50413178|ref|XP_457218.1| unnamed protein product [Debaryomyc... 42 0.004
gi|48838252|ref|ZP_00295198.1| COG1958: Small nuclear ribonucleo... 42 0.004
gi|21228485|ref|NP_634407.1| Small nuclear riboprotein-like prot... 42 0.004
gi|39595458|emb|CAE60496.1| Hypothetical protein CBG04114 [Caeno... 42 0.004
gi|12230329|sp|Q9ZRU9|LSM4_FAGSY Probable U6 snRNA-associated Sm... 42 0.004
gi|14602195|ref|NP_147628.1| homolog of small nuclear ribonucleo... 42 0.004
gi|20090273|ref|NP_616348.1| Sm protein [Methanosarcina acetivor... 41 0.006
gi|37806009|dbj|BAC99422.1| putative snRNP core protein SMX5d [O... 41 0.006
gi|49076098|ref|XP_402061.1| hypothetical protein UM04446.1 [Ust... 41 0.008
gi|45358711|ref|NP_988268.1| Small nuclear ribonucleoprotein (Sm... 41 0.008
gi|49097780|ref|XP_410350.1| hypothetical protein AN6213.2 [Aspe... 40 0.010
gi|14600779|ref|NP_147300.1| small nuclear ribonucleoprotein [Ae... 40 0.017
gi|17510511|ref|NP_491032.1| small nuclear ribonucleoprotein pol... 40 0.017
gi|15224075|ref|NP_179971.1| small nuclear ribonucleoprotein G, ... 39 0.022
gi|37991869|gb|AAR06315.1| putative small nuclear ribonucleoprot... 39 0.022
gi|15241028|ref|NP_198124.1| small nuclear ribonucleoprotein, pu... 39 0.029
gi|21593495|gb|AAM65462.1| glycine rich protein-like [Arabidopsi... 39 0.029
gi|32420717|ref|XP_330802.1| hypothetical protein [Neurospora cr... 39 0.029
gi|12230291|sp|Q9LGE6|LSM4_ORYSA Probable U6 snRNA-associated Sm... 39 0.029
gi|31206519|ref|XP_312222.1| ENSANGP00000010868 [Anopheles gambi... 39 0.029
gi|34902916|ref|NP_912805.1| unnamed protein product [Oryza sati... 39 0.029
gi|39582333|emb|CAE67582.1| Hypothetical protein CBG13115 [Caeno... 39 0.038
gi|16944624|emb|CAD11394.1| probable U6 SNRNA-ASSOCIATED SM-LIKE... 39 0.038
gi|17533617|ref|NP_495514.1| u6 snRNA-associated Sm-like protein... 39 0.038
gi|23508277|ref|NP_700946.1| U6 snRNA associated Sm-like protein... 39 0.038
gi|12230258|sp|Q43582|LSM4_TOBAC Probable U6 snRNA-associated Sm... 39 0.038
gi|15229773|ref|NP_187757.1| small nuclear ribonucleoprotein G, ... 39 0.038
gi|50294275|ref|XP_449549.1| unnamed protein product [Candida gl... 38 0.050
gi|42557773|emb|CAF28746.1| hypothetical protein [uncultured cre... 38 0.050
gi|46121885|ref|XP_385496.1| hypothetical protein FG05320.1 [Gib... 38 0.065
gi|50425663|ref|XP_461428.1| unnamed protein product [Debaryomyc... 38 0.065
gi|20260282|gb|AAM13039.1| unknown protein [Arabidopsis thaliana... 37 0.085
gi|50425359|ref|XP_461273.1| unnamed protein product [Debaryomyc... 37 0.085
gi|46107748|ref|XP_380933.1| conserved hypothetical protein [Gib... 37 0.085
gi|17560310|ref|NP_506870.1| u6 snRNA-associated Sm-like protein... 37 0.085
gi|39582859|emb|CAE71635.1| Hypothetical protein CBG18602 [Caeno... 37 0.085
gi|13541906|ref|NP_111594.1| Small nuclear ribonucleoprotein (sn... 37 0.085
gi|15239727|ref|NP_199698.1| small nuclear ribonucleoprotein, pu... 37 0.085
gi|47217413|emb|CAG00773.1| unnamed protein product [Tetraodon n... 37 0.11
gi|23485036|gb|EAA20166.1| Sm protein, putative [Plasmodium yoel... 37 0.11
gi|41718944|ref|ZP_00147889.1| COG1958: Small nuclear ribonucleo... 37 0.11
gi|23612793|ref|NP_704332.1| small nuclear ribonucleoprotein, pu... 37 0.14
gi|46105464|ref|XP_380536.1| hypothetical protein FG00360.1 [Gib... 37 0.14
gi|50255971|gb|EAL18700.1| hypothetical protein CNBI2880 [Crypto... 37 0.14
gi|50260314|gb|EAL22973.1| hypothetical protein CNBA7410 [Crypto... 37 0.14
gi|7451052|pir||S22826 small nuclear ribonucleoprotein E homolog... 36 0.19
gi|134126|sp|P24715|RUXG_MEDSA Probable small nuclear ribonucleo... 36 0.19
gi|50555508|ref|XP_505162.1| hypothetical protein [Yarrowia lipo... 36 0.19
gi|27668769|ref|XP_214318.1| similar to U6 snRNA-associated Sm-l... 36 0.19
gi|12834762|dbj|BAB23033.1| unnamed protein product [Mus musculus] 36 0.19
gi|45361593|ref|NP_989371.1| hypothetical protein MGC76085 [Xeno... 36 0.19
gi|7657317|ref|NP_056631.1| LSM4 homolog, U6 small nuclear RNA a... 36 0.19
gi|41152340|ref|NP_956990.1| LSM4 homolog, U6 small nuclear RNA ... 36 0.19
gi|16081975|ref|NP_394385.1| hypothetical protein [Thermoplasma ... 36 0.19
gi|50761130|ref|XP_418245.1| PREDICTED: similar to Hypothetical ... 36 0.19
gi|49079848|ref|XP_403524.1| hypothetical protein UM05909.1 [Ust... 36 0.19
gi|6912486|ref|NP_036453.1| U6 snRNA-associated Sm-like protein ... 36 0.19
gi|13161882|emb|CAC33027.1| Lsm4 protein [Takifugu rubripes] 36 0.19
gi|27659256|ref|XP_226489.1| similar to snRNP core protein SMX5d... 36 0.25
gi|49087384|ref|XP_405632.1| hypothetical protein AN1495.2 [Aspe... 36 0.25
gi|48106301|ref|XP_396083.1| similar to CG10418-PA [Apis mellifera] 36 0.25
gi|23489340|gb|EAA21551.1| hypothetical protein [Plasmodium yoel... 36 0.25
gi|32415822|ref|XP_328389.1| hypothetical protein [Neurospora cr... 36 0.25
gi|19113165|ref|NP_596373.1| putative U6 snRNA-associated protei... 36 0.25
gi|50545209|ref|XP_500142.1| hypothetical protein [Yarrowia lipo... 36 0.25
gi|50309253|ref|XP_454633.1| unnamed protein product [Kluyveromy... 35 0.32
gi|46237602|emb|CAE83980.1| LSM2 homolog, U6 small nuclear RNA a... 35 0.32
gi|13994221|ref|NP_085100.1| snRNP core protein SMX5; dystrophia... 35 0.32
gi|45550963|ref|NP_723584.2| CG31990-PA [Drosophila melanogaster... 35 0.32
gi|25012547|gb|AAN71375.1| RE35747p [Drosophila melanogaster] 35 0.32
gi|32414377|ref|XP_327668.1| hypothetical protein [Neurospora cr... 35 0.32
gi|50545379|ref|XP_500227.1| hypothetical protein [Yarrowia lipo... 35 0.32
gi|31232706|ref|XP_318746.1| ENSANGP00000016613 [Anopheles gambi... 35 0.32
gi|38047763|gb|AAR09784.1| similar to Drosophila melanogaster CG... 35 0.32
gi|31210107|ref|XP_314020.1| ENSANGP00000010025 [Anopheles gambi... 35 0.32
gi|21358381|ref|NP_648570.1| CG10418-PA [Drosophila melanogaster... 35 0.32
gi|11138539|gb|AAG31434.1| snRNP core protein SMX5d [Mus musculus] 35 0.32
gi|10863977|ref|NP_067000.1| LSM2 homolog, U6 small nuclear RNA ... 35 0.32
gi|21730739|pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like ... 35 0.42
gi|2113818|emb|CAB05859.1| AmphiBrf43 [Branchiostoma floridae] 35 0.42
gi|11497974|ref|NP_069198.1| snRNP, putative [Archaeoglobus fulg... 35 0.42
gi|14192871|gb|AAK55776.1| Putative small nuclear ribonucleoprot... 35 0.42
gi|29251532|gb|EAA43013.1| GLP_170_167704_168030 [Giardia lambli... 35 0.42
gi|6320958|ref|NP_011037.1| Like Sm-D3 protein; Lsm4p [Saccharom... 34 0.72
gi|605651|gb|AAA58257.1| regulatory protein 34 0.72
gi|29249017|gb|EAA40538.1| GLP_680_47464_47838 [Giardia lamblia ... 34 0.94
gi|41614834|ref|NP_963332.1| NEQ037 [Nanoarchaeum equitans Kin4-... 34 0.94
gi|17561850|ref|NP_506348.1| u6 snRNA-associated Sm-like protein... 34 0.94
gi|23484203|gb|EAA19613.1| putative small nuclear ribonucleoprot... 33 1.2
gi|46124883|ref|XP_386995.1| conserved hypothetical protein [Gib... 33 1.2
gi|50307679|ref|XP_453819.1| unnamed protein product [Kluyveromy... 33 1.2
gi|50255852|gb|EAL18583.1| hypothetical protein CNBJ0090 [Crypto... 33 1.6
gi|50260161|gb|EAL22822.1| hypothetical protein CNBB0430 [Crypto... 33 1.6
gi|29726438|pdb|1M5Q|A Chain A, Crystal Structure Of A Novel Sm-... 33 1.6
gi|19173042|ref|NP_597593.1| similarity to SMALL NUCLEAR RIBONUC... 33 1.6
gi|29245184|gb|EAA36838.1| GLP_122_3813_3433 [Giardia lamblia AT... 33 1.6
gi|18313113|ref|NP_559780.1| small nuclear ribonucleoprotein hom... 33 1.6
gi|23489339|gb|EAA21550.1| hypothetical protein [Plasmodium yoel... 33 2.1
gi|49073764|ref|XP_401067.1| hypothetical protein UM03452.1 [Ust... 33 2.1
gi|46229827|gb|EAK90645.1| U6 snRNA-associated Sm-like protein L... 33 2.1
gi|46229816|gb|EAK90634.1| hypothetical protein cgd7_3520 [Crypt... 33 2.1
gi|44890026|emb|CAF32144.1| u6 snrna-associated sm-like protein,... 33 2.1
gi|13812403|ref|NP_113521.1| putative small nuclear ribonucleopr... 32 2.7
gi|49069150|ref|XP_398864.1| hypothetical protein UM01249.1 [Ust... 32 2.7
gi|19074604|ref|NP_586110.1| putative U6 snRNA-ASSOCIATED SM-LIK... 32 2.7
gi|47218886|emb|CAG05652.1| unnamed protein product [Tetraodon n... 32 2.7
gi|45200940|ref|NP_986510.1| AGL157Cp [Eremothecium gossypii] >g... 32 2.7
gi|15790491|ref|NP_280315.1| snRNP homolog; Snp [Halobacterium s... 32 2.7
gi|49088696|ref|XP_406144.1| conserved hypothetical protein [Asp... 32 2.7
gi|23482828|gb|EAA18696.1| dynein beta chain, ciliary [Plasmodiu... 32 3.6
gi|46806276|dbj|BAD17484.1| putative small nuclear ribonucleopro... 32 3.6
gi|50421915|ref|XP_459516.1| unnamed protein product [Debaryomyc... 32 3.6
gi|32417284|ref|XP_329120.1| hypothetical protein [Neurospora cr... 32 3.6
gi|46436659|gb|EAK96018.1| hypothetical protein CaO19.7256 [Cand... 32 3.6
gi|46130650|ref|XP_389105.1| hypothetical protein FG08929.1 [Gib... 32 4.7
gi|14318502|ref|NP_116636.1| snRNP G protein (the homologue of t... 32 4.7
gi|45199029|ref|NP_986058.1| AFR511Cp [Eremothecium gossypii] >g... 32 4.7
gi|38100589|gb|EAA47695.1| hypothetical protein MG02938.4 [Magna... 32 4.7
gi|27732753|ref|XP_232769.1| similar to small nuclear ribonucleo... 32 4.7
gi|19115525|ref|NP_594613.1| small nuclear ribonucleoprotein smd... 32 4.7
gi|27545253|ref|NP_775359.1| small nuclear ribonucleoprotein D1 ... 31 6.1
gi|49085588|ref|XP_404904.1| hypothetical protein AN0767.2 [Aspe... 31 7.9
gi|17542052|ref|NP_503027.1| small nuclear ribonucleoprotein, sm... 31 7.9
gi|12311835|emb|CAC22653.1| hypothetical protein L2385.08 [Leish... 31 7.9
gi|46123175|ref|XP_386141.1| hypothetical protein FG05965.1 [Gib... 31 7.9
gi|23509633|ref|NP_702300.1| small nuclear ribonuclear protein, ... 31 7.9
gi|50582694|gb|AAT78764.1| putative zinc-finger protein [Oryza s... 31 7.9
gi|19173631|ref|NP_597434.1| SMALL NUCLEAR RIBONUCLEOPROTEIN G [... 31 7.9
gi|21703324|gb|AAM76159.1| U7 snRNP-specific SM-like protein [Bo... 31 7.9
>gi|17510579|ref|NP_490883.1| u6 snRNA-associated Sm-like protein
(lsm-5) [Caenorhabditis elegans]
gi|14916400|gb|AAK73913.1| Lsm sm-like protein protein 6
[Caenorhabditis elegans]
Length = 77
Score = 156 bits (395), Expect = 1e-37
Identities = 77/77 (100%), Positives = 77/77 (100%)
Frame = +1
Query: 1 MSKRQNPAEFLKKVIGKPVVVKLNSGVDYRGILACLDGYMNIALEQTEEYSNGQLQNKYG 180
MSKRQNPAEFLKKVIGKPVVVKLNSGVDYRGILACLDGYMNIALEQTEEYSNGQLQNKYG
Sbjct: 1 MSKRQNPAEFLKKVIGKPVVVKLNSGVDYRGILACLDGYMNIALEQTEEYSNGQLQNKYG 60
Query: 181 DAFIRGNNVLYISTSTK 231
DAFIRGNNVLYISTSTK
Sbjct: 61 DAFIRGNNVLYISTSTK 77