Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y71H2AM_6
(588 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17556434|ref|NP_497608.1| GTP-binding protein like (22.2 kD) ... 392 e-108
gi|15232784|ref|NP_187601.1| Ras-related GTP-binding protein, pu... 135 7e-31
gi|15242773|ref|NP_195972.1| Ras-related GTP-binding protein, pu... 133 2e-30
gi|21592670|gb|AAM64619.1| putative Ras-like GTP-binding protein... 132 4e-30
gi|1370194|emb|CAA98174.1| RAB8C [Lotus corniculatus var. japoni... 132 6e-30
gi|46434549|gb|EAK93955.1| hypothetical protein CaO19.714 [Candi... 132 6e-30
gi|46434574|gb|EAK93979.1| hypothetical protein CaO19.8333 [Cand... 132 6e-30
gi|1362067|pir||S57478 GTP-binding protein GTP13 - garden pea >g... 131 8e-30
gi|1362065|pir||S57462 GTP-binding protein GTP11 - garden pea >g... 131 8e-30
gi|29124128|gb|AAO65869.1| ethylene-responsive small GTP-binding... 131 8e-30
gi|1370190|emb|CAA98172.1| RAB8A [Lotus corniculatus var. japoni... 131 1e-29
gi|18447917|dbj|BAB84324.1| ras-related protein RAB8-3 [Nicotian... 130 1e-29
gi|18447913|dbj|BAB84322.1| ras-related protein RAB8-1 [Nicotian... 130 1e-29
gi|15231847|ref|NP_190929.1| Ras-related GTP-binding protein, pu... 130 1e-29
gi|18447915|dbj|BAB84323.1| ras-related protein RAB8-2 [Nicotian... 130 1e-29
gi|15238542|ref|NP_200792.1| Ras-related GTP-binding family prot... 130 2e-29
gi|47900325|gb|AAT39172.1| putative GTP-binding protein [Oryza s... 130 2e-29
gi|1370198|emb|CAA98176.1| RAB8E [Lotus corniculatus var. japoni... 130 2e-29
gi|33146687|dbj|BAC80082.1| putative ethylene-responsive small G... 130 2e-29
gi|3024527|sp|Q39433|RAB1_BETVU Ras-related protein RAB1BV >gnl|... 130 2e-29
gi|1362066|pir||S57471 GTP-binding protein GTP6 - garden pea >gn... 130 2e-29
gi|38175435|dbj|BAC83185.2| putative ras-related protein [Oryza ... 130 2e-29
gi|2500073|sp|Q39571|YPT1_CHLRE GTP-binding protein YPTC1 >gnl|B... 130 2e-29
gi|1370196|emb|CAA98175.1| RAB8D [Lotus corniculatus var. japoni... 129 4e-29
gi|7438394|pir||T14405 small GTP-binding protein rab-1 - turnip ... 129 5e-29
gi|18447921|dbj|BAB84326.1| ras-related protein RAB8-5 [Nicotian... 129 5e-29
gi|15231322|ref|NP_190192.1| Ras-related protein (ARA-3) / small... 129 5e-29
gi|2808638|emb|CAA04701.1| small GTP-binding protein [Daucus car... 128 9e-29
gi|5669640|gb|AAD46405.1| ethylene-responsive small GTP-binding ... 128 9e-29
gi|46326983|gb|AAS88430.1| ethylene-responsive small GTP-binding... 128 9e-29
gi|479442|pir||S33900 GTP-binding protein ypt2 - tomato >gnl|BL_... 127 1e-28
gi|549809|sp|P36861|YPT2_VOLCA GTP-binding protein yptV2 >gnl|BL... 127 2e-28
gi|401686|sp|P31584|YPT1_VOLCA GTP-binding protein yptV1 >gnl|BL... 127 2e-28
gi|17553774|ref|NP_498993.1| RAB family member (23.3 kD) (rab-6.... 126 3e-28
gi|50311935|ref|XP_455999.1| unnamed protein product [Kluyveromy... 125 6e-28
gi|24648682|ref|NP_732610.1| CG3320-PA [Drosophila melanogaster]... 125 8e-28
gi|49074732|ref|XP_401480.1| hypothetical protein UM03865.1 [Ust... 124 1e-27
gi|1362064|pir||S57474 GTP-binding protein - garden pea >gnl|BL_... 124 1e-27
gi|39585054|emb|CAE62705.1| Hypothetical protein CBG06854 [Caeno... 124 1e-27
gi|50422037|ref|XP_459580.1| unnamed protein product [Debaryomyc... 124 2e-27
gi|17737369|ref|NP_523419.1| CG17060-PA [Drosophila melanogaster... 122 4e-27
gi|27709432|ref|XP_229035.1| similar to Ras-related protein Rab-... 122 4e-27
gi|92339|pir||S06147 GTP-binding protein rab1B - rat >gnl|BL_ORD... 122 4e-27
gi|23613148|ref|NP_703470.1| GTPase, putative [Plasmodium falcip... 122 5e-27
gi|6323291|ref|NP_013363.1| Ras-like GTP binding protein involve... 122 5e-27
gi|27817324|emb|CAD61089.1| SI:zC101N13.3 (novel protein similar... 122 5e-27
gi|131803|sp|P10536|RB1B_RAT Ras-related protein Rab-1B >gnl|BL_... 122 5e-27
gi|47087033|ref|NP_998530.1| zgc:63637 [Danio rerio] >gnl|BL_ORD... 122 5e-27
gi|31208125|ref|XP_313029.1| ENSANGP00000011746 [Anopheles gambi... 122 6e-27
gi|48104721|ref|XP_392967.1| similar to CG3320-PA [Apis mellifera] 122 6e-27
gi|50731203|ref|XP_417213.1| PREDICTED: similar to RAB30 [Gallus... 122 6e-27
gi|48096836|ref|XP_392533.1| similar to ENSANGP00000020507 [Apis... 121 8e-27
gi|464524|sp|Q05974|RAB1_LYMST Ras-related protein Rab-1A >gnl|B... 121 8e-27
gi|29789271|ref|NP_112354.1| RAB13 [Rattus norvegicus] >gnl|BL_O... 121 8e-27
gi|45361477|ref|NP_989315.1| hypothetical protein MGC76176 [Xeno... 121 1e-26
gi|50292103|ref|XP_448484.1| unnamed protein product [Candida gl... 121 1e-26
gi|7438417|pir||JE0318 GTP-binding protein rabB - silkworm >gnl|... 120 1e-26
gi|50254827|gb|EAL17571.1| hypothetical protein CNBM0510 [Crypto... 120 1e-26
gi|21313162|ref|NP_083852.1| RIKEN cDNA 1110011F09 [Mus musculus... 120 1e-26
gi|48766845|gb|AAT46563.1| Rab [Marsupenaeus japonicus] 120 1e-26
gi|21311975|ref|NP_080953.1| RAS-associated protein RAB13 [Mus m... 120 2e-26
gi|41152205|ref|NP_958486.1| RAB13, member RAS oncogene family [... 120 2e-26
gi|31204497|ref|XP_311197.1| ENSANGP00000019091 [Anopheles gambi... 120 2e-26
gi|14318517|ref|NP_116650.1| Secretory vesicle associated Rab GT... 120 2e-26
gi|131787|sp|P05711|RB1A_RAT Ras-related protein Rab-1A >gnl|BL_... 120 2e-26
gi|541978|pir||S41430 GTP-binding protein, ras-like (clone vfa-y... 120 2e-26
gi|40225607|gb|AAH09227.2| RAB13 protein [Homo sapiens] 120 2e-26
gi|45201353|ref|NP_986923.1| AGR257Cp [Eremothecium gossypii] >g... 120 2e-26
gi|12084567|pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanos... 120 2e-26
gi|49257311|gb|AAH73168.1| RAB13 protein [Homo sapiens] 120 2e-26
gi|37747686|gb|AAH60015.1| MGC68629 protein [Xenopus laevis] 120 2e-26
gi|134228|sp|P20790|SAS1_DICDI GTP-binding protein SAS1 >gnl|BL_... 120 2e-26
gi|17137220|ref|NP_477172.1| CG6601-PA [Drosophila melanogaster]... 120 2e-26
gi|49065350|emb|CAG38493.1| RAB1B [Homo sapiens] 120 2e-26
gi|4506363|ref|NP_002861.1| RAB13, member RAS oncogene family; R... 120 2e-26
gi|5902803|sp|P28188|ARA5_ARATH Ras-related protein ARA-5 >gnl|B... 119 3e-26
gi|217841|dbj|BAA00832.1| small GTP-binding protein [Arabidopsis... 119 3e-26
gi|34906164|ref|NP_914429.1| putative GTP-binding protein [Oryza... 119 3e-26
gi|81634|pir||PS0279 GTP-binding protein ara-5 - Arabidopsis tha... 119 3e-26
gi|13195674|ref|NP_077249.1| RAB6, member RAS oncogene family [M... 119 3e-26
gi|38679888|ref|NP_942599.1| RAB6A, member RAS oncogene family i... 119 3e-26
gi|28302338|gb|AAH46683.1| Rab6-prov protein [Xenopus laevis] 119 3e-26
gi|13569962|ref|NP_112243.1| RAB1B, member RAS oncogene family; ... 119 3e-26
gi|21361418|ref|NP_055303.2| RAB30, member RAS oncogene family [... 119 3e-26
gi|14140133|emb|CAC39050.1| putative GTP-binding protein [Oryza ... 119 3e-26
gi|15217622|ref|NP_171715.1| Ras-related protein (ARA-5) / small... 119 3e-26
gi|45201075|ref|NP_986645.1| AGL021Wp [Eremothecium gossypii] >g... 119 4e-26
gi|31227879|ref|XP_317957.1| ENSANGP00000020507 [Anopheles gambi... 119 4e-26
gi|17570073|ref|NP_510790.1| RAB family member (23.4 kD) (rab-6.... 119 4e-26
gi|39596053|emb|CAE69689.1| Hypothetical protein CBG15944 [Caeno... 119 4e-26
gi|49080386|ref|XP_403719.1| hypothetical protein UM06104.1 [Ust... 119 4e-26
gi|50308977|ref|XP_454494.1| unnamed protein product [Kluyveromy... 119 4e-26
gi|131785|sp|P22125|RAB1_DISOM Ras-related protein ORAB-1 >gnl|B... 119 5e-26
gi|5764095|gb|AAD51132.1| small GTP-binding protein rab1 [Theile... 119 5e-26
gi|47222415|emb|CAG12935.1| unnamed protein product [Tetraodon n... 119 5e-26
gi|50287271|ref|XP_446065.1| unnamed protein product [Candida gl... 119 5e-26
gi|47222578|emb|CAG02943.1| unnamed protein product [Tetraodon n... 119 5e-26
gi|134236|sp|P20791|SAS2_DICDI GTP-binding protein SAS2 >gnl|BL_... 119 5e-26
gi|12084563|pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp >g... 118 7e-26
gi|131804|sp|P24409|RB10_CANFA Ras-related protein Rab-10 >gnl|B... 118 7e-26
gi|17512290|gb|AAH19118.1| Rab6 protein [Mus musculus] 118 7e-26
gi|19923231|ref|NP_002860.2| RAB6A, member RAS oncogene family i... 118 7e-26
gi|47228262|emb|CAG07657.1| unnamed protein product [Tetraodon n... 118 7e-26
gi|1616614|emb|CAA69701.1| small GTP-binding protein [Nicotiana ... 118 7e-26
gi|466172|sp|Q05737|YPT2_MAIZE GTP-binding protein YPTM2 >gnl|BL... 118 7e-26
gi|27924279|gb|AAH45014.1| Rab1-prov protein [Xenopus laevis] >g... 118 9e-26
gi|47225306|emb|CAG09806.1| unnamed protein product [Tetraodon n... 118 9e-26
gi|41055496|ref|NP_957436.1| similar to RAB1, member RAS oncogen... 118 9e-26
gi|303750|dbj|BAA02116.1| GTP-binding protein [Pisum sativum] >g... 117 1e-25
gi|47211161|emb|CAF92536.1| unnamed protein product [Tetraodon n... 117 1e-25
gi|50738954|ref|XP_419342.1| PREDICTED: similar to ras-related p... 117 1e-25
gi|12843097|dbj|BAB25858.1| unnamed protein product [Mus musculus] 117 1e-25
gi|7710086|ref|NP_057885.1| RAB10, member RAS oncogene family [M... 117 1e-25
gi|33695095|ref|NP_057215.2| ras-related GTP-binding protein RAB... 117 1e-25
gi|4758988|ref|NP_004152.1| RAB1A, member RAS oncogene family; R... 117 1e-25
gi|50540198|ref|NP_001002566.1| zgc:92757 [Danio rerio] >gnl|BL_... 117 1e-25
gi|47225841|emb|CAF98321.1| unnamed protein product [Tetraodon n... 117 2e-25
gi|15224916|ref|NP_181989.1| Ras-related GTP-binding protein, pu... 117 2e-25
gi|49257610|gb|AAH74238.1| Unknown (protein for MGC:83971) [Xeno... 117 2e-25
gi|2500076|sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT... 117 2e-25
gi|47937791|gb|AAH72360.1| MGC83515 protein [Xenopus laevis] 117 2e-25
gi|50259473|gb|EAL22146.1| hypothetical protein CNBC2840 [Crypto... 117 2e-25
gi|39586275|emb|CAE66686.1| Hypothetical protein CBG12025 [Caeno... 117 2e-25
gi|15238317|ref|NP_201304.1| Ras-related GTP-binding protein, pu... 117 2e-25
gi|4586580|dbj|BAA76422.1| rab-type small GTP-binding protein [C... 117 2e-25
gi|25294107|pir||JC7589 Sec4p homolog - yeast (Pichia pastoris) ... 117 2e-25
gi|2136076|pir||JC4962 rab protein 30 - human >gnl|BL_ORD_ID|188... 117 2e-25
gi|1053063|gb|AAA80678.1| small GTP-binding protein 117 2e-25
gi|421942|pir||S34253 GTP-binding protein, ras-related - common ... 117 2e-25
gi|23463313|ref|NP_695229.1| GTPase Rab8b [Rattus norvegicus] >g... 116 3e-25
gi|7706563|ref|NP_057614.1| RAB8B, member RAS oncogene family; R... 116 3e-25
gi|6759651|gb|AAF27978.1| GTP binding protein; Rab6 [Plasmodium ... 116 3e-25
gi|23481886|gb|EAA18032.1| Rab6 [Plasmodium yoelii yoelii] 116 3e-25
gi|49456921|emb|CAG46781.1| RAB6A [Homo sapiens] 116 3e-25
gi|7498104|pir||T33855 hypothetical protein D1037.4 - Caenorhabd... 116 3e-25
gi|19114161|ref|NP_593249.1| gtp-binding protein ryh1 [Schizosac... 116 3e-25
gi|25150215|ref|NP_491199.2| RAB family member (24.0 kD) (rab-8)... 116 3e-25
gi|37360618|dbj|BAC98287.1| mKIAA3012 protein [Mus musculus] 116 3e-25
gi|47225370|emb|CAG11853.1| unnamed protein product [Tetraodon n... 116 3e-25
gi|12856302|dbj|BAB30625.1| unnamed protein product [Mus musculus] 116 3e-25
gi|49250515|gb|AAH74609.1| Unknown (protein for MGC:69471) [Xeno... 116 3e-25
gi|1370164|emb|CAA98159.1| RAB1B [Lotus corniculatus var. japoni... 115 5e-25
gi|7706675|ref|NP_057661.1| RAB6B, member RAS oncogene family; s... 115 5e-25
gi|38106736|gb|EAA53007.1| hypothetical protein MG06135.4 [Magna... 115 6e-25
gi|27734452|sp|P59190|RB15_HUMAN Ras-related protein Rab-15 115 6e-25
gi|38454238|ref|NP_942044.1| Ras-related protein Rab-15 [Rattus ... 115 6e-25
gi|23490566|gb|EAA22313.1| Rab1 protein [Plasmodium yoelii yoelii] 115 6e-25
gi|464523|sp|P34139|RB1A_DICDI Ras-related protein Rab1A >gnl|BL... 115 6e-25
gi|41148993|ref|XP_372086.1| similar to RAB1B, member RAS oncoge... 115 6e-25
gi|303732|dbj|BAA02117.1| GTP-binding protein [Pisum sativum] >g... 115 6e-25
gi|14475537|emb|CAC41973.1| putative Rab/GTPase [Colletotrichum ... 115 8e-25
gi|131847|sp|P22127|RB10_DISOM Ras-related protein Rab-10 (ORA1)... 115 8e-25
gi|1370166|emb|CAA98160.1| RAB1C [Lotus corniculatus var. japoni... 114 1e-24
gi|18422766|ref|NP_568678.1| Ras-related GTP-binding protein, pu... 114 1e-24
gi|31559981|ref|NP_598811.2| RAB15, member RAS oncogene family [... 114 1e-24
gi|19115492|ref|NP_594580.1| ypt1-related protein 2 [Schizosacch... 114 1e-24
gi|420269|pir||B42148 GTP-binding protein rab10 - rat 114 1e-24
gi|49074658|ref|XP_401448.1| YPT1_NEUCR GTP-binding protein ypt1... 114 1e-24
gi|50752811|ref|XP_413757.1| PREDICTED: similar to GTPase Rab8b ... 114 1e-24
gi|730510|sp|P40392|RIC1_ORYSA Ras-related protein RIC1 >gnl|BL_... 114 1e-24
gi|15077428|gb|AAK83158.1| small GTP-binding protein Ypt1p [Cand... 114 1e-24
gi|50604253|gb|AAH78133.1| Unknown (protein for MGC:84543) [Xeno... 114 1e-24
gi|32492050|gb|AAP85297.1| Rab1b [Babesia bovis] 114 1e-24
gi|50306647|ref|XP_453297.1| unnamed protein product [Kluyveromy... 114 1e-24
gi|50413456|ref|XP_457265.1| unnamed protein product [Debaryomyc... 114 1e-24
gi|7438385|pir||T03627 GTP-binding protein Rab6 - common tobacco... 114 1e-24
gi|32411557|ref|XP_326259.1| RAS-RELATED PROTEIN RAB1BV [Neurosp... 114 1e-24
gi|103720|pir||D38625 GTP-binding protein o-rab1 - electric ray ... 114 1e-24
gi|34914060|ref|NP_918377.1| putative RIC1_ORYSA RAS-RELATED PRO... 114 1e-24
gi|46123663|ref|XP_386385.1| hypothetical protein FG06209.1 [Gib... 114 1e-24
gi|11558647|emb|CAC17832.1| secretion related GTPase, (SrgA) [As... 114 2e-24
gi|17737663|ref|NP_524172.1| CG8287-PA [Drosophila melanogaster]... 114 2e-24
gi|131848|sp|P22128|RAB8_DISOM Ras-related protein Rab-8 (ORA2) ... 114 2e-24
gi|39588485|emb|CAE58008.1| Hypothetical protein CBG01077 [Caeno... 114 2e-24
gi|17558550|ref|NP_503397.1| RAB family member (22.5 kD) (rab-1)... 114 2e-24
gi|541948|pir||S39565 GTP-binding protein rab1 - soybean >gnl|BL... 114 2e-24
gi|46111195|ref|XP_382655.1| conserved hypothetical protein [Gib... 114 2e-24
gi|18266415|gb|AAL67567.1| small GTP binding protein rab6 [Babes... 114 2e-24
gi|49102994|ref|XP_411111.1| hypothetical protein AN6974.2 [Aspe... 113 2e-24
gi|1575675|gb|AAC47440.1| rab6 [Plasmodium falciparum] 113 2e-24
gi|15236555|ref|NP_193486.1| Ras-related GTP-binding protein, pu... 113 3e-24
gi|11558500|emb|CAC17744.1| small GTP-binding protein YPTI [Hypo... 113 3e-24
gi|16974365|gb|AAL31108.1| AT4g17530/dl4800c [Arabidopsis thaliana] 113 3e-24
gi|7438375|pir||H71444 GTP-binding protein - Arabidopsis thalian... 113 3e-24
gi|47224370|emb|CAG09216.1| unnamed protein product [Tetraodon n... 113 3e-24
gi|45360657|ref|NP_989002.1| hypothetical protein MGC75714 [Xeno... 113 3e-24
gi|82803|pir||S04590 GTP-binding protein ypt1 - fission yeast (... 112 4e-24
gi|15227173|ref|NP_179816.1| Ras-related GTP-binding protein, pu... 112 4e-24
gi|11274352|pir||T50814 GTP-binding protein - Arabidopsis thalia... 112 4e-24
gi|45185452|ref|NP_983169.1| ABR220Wp [Eremothecium gossypii] >g... 112 4e-24
gi|1370192|emb|CAA98173.1| RAB8B [Lotus corniculatus var. japoni... 112 4e-24
gi|24306110|gb|AAN52527.1| GTP-binding protein [Pichia angusta] ... 112 4e-24
gi|19112997|ref|NP_596205.1| ypt1-related protein 1 [Schizosacch... 112 4e-24
gi|1053067|gb|AAA80680.1| small GTP-binding protein 112 4e-24
gi|1370170|emb|CAA98162.1| RAB1E [Lotus corniculatus var. japoni... 112 4e-24
gi|7643790|gb|AAF65510.1| small GTP-binding protein [Capsicum an... 112 4e-24
gi|32492048|gb|AAP85296.1| Rab1a [Babesia bovis] 112 4e-24
gi|1628428|emb|CAA63555.1| GTPase; RAB6 [Plasmodium falciparum 3D7] 112 5e-24
gi|31243023|ref|XP_321946.1| ENSANGP00000013866 [Anopheles gambi... 112 5e-24
gi|32418088|ref|XP_329522.1| GTP-BINDING PROTEIN YPT1 [Neurospor... 112 5e-24
gi|47209142|emb|CAF90455.1| unnamed protein product [Tetraodon n... 112 5e-24
gi|37545057|ref|XP_113967.2| similar to Rab12 protein [Homo sapi... 112 5e-24
gi|1370162|emb|CAA66447.1| RAB1A [Lotus corniculatus var. japoni... 112 5e-24
gi|32398899|emb|CAD98364.1| small GTP binding protein rab1a, pro... 112 5e-24
gi|466171|sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 >gnl|BL_... 112 5e-24
gi|1381678|gb|AAB97115.1| small GTP-binding protein [Glycine max] 112 7e-24
gi|38109427|gb|EAA55305.1| hypothetical protein MG06962.4 [Magna... 112 7e-24
gi|7438373|pir||S72515 GTP-binding protein RAB1 - garden petunia... 112 7e-24
gi|13397937|emb|CAC34627.1| putative Rab2 GTPase [Plasmodium fal... 112 7e-24
gi|50256143|gb|EAL18870.1| hypothetical protein CNBI1310 [Crypto... 112 7e-24
gi|1710015|sp|P51152|RB12_CANFA Ras-related protein Rab-12 >gnl|... 112 7e-24
gi|1370168|emb|CAA98161.1| RAB1D [Lotus corniculatus var. japoni... 112 7e-24
gi|15236081|ref|NP_195699.1| Ras-related GTP-binding family prot... 112 7e-24
gi|7438392|pir||T14391 GTP-binding protein homolog - turnip >gnl... 111 9e-24
gi|46138717|ref|XP_391049.1| YPT1_NEUCR GTP-binding protein ypt1... 111 9e-24
gi|23613161|ref|NP_703483.1| Rab1 protein [Plasmodium falciparum... 111 9e-24
gi|4585808|emb|CAB40900.1| putative Rab1A protein [Plasmodium fa... 111 9e-24
gi|49093914|ref|XP_408418.1| YPT1_NEUCR GTP-binding protein ypt1... 111 9e-24
gi|23480789|gb|EAA17254.1| putative Rab2 GTPase [Plasmodium yoel... 111 9e-24
gi|23508994|ref|NP_701662.1| Rab2 GTPase, putative [Plasmodium f... 111 9e-24
gi|227603|prf||1707300A guanine nucleotide binding protein 111 9e-24
gi|50418486|gb|AAH77124.1| Unknown (protein for MGC:100812) [Dan... 111 9e-24
gi|303748|dbj|BAA02115.1| GTP-binding protein [Pisum sativum] >g... 111 9e-24
gi|11558649|emb|CAC17833.1| secretion related GTPase (SrgB) [Asp... 111 9e-24
gi|1710002|sp|P55258|RB8A_MOUSE Ras-related protein Rab-8A (Onco... 111 1e-23
gi|234746|gb|AAB19681.1| RAS-related protein MEL [Homo sapiens] 111 1e-23
gi|49522647|gb|AAH71176.1| Unknown (protein for IMAGE:7098881) [... 111 1e-23
gi|50550177|ref|XP_502561.1| hypothetical protein [Yarrowia lipo... 111 1e-23
gi|16933567|ref|NP_005361.2| mel transforming oncogene; ras-asso... 111 1e-23
gi|38372905|ref|NP_075615.2| cell line NK14 derived transforming... 111 1e-23
gi|30585389|gb|AAP36967.1| Homo sapiens mel transforming oncogen... 111 1e-23
gi|45360691|ref|NP_989019.1| hypothetical protein MGC76044 [Xeno... 111 1e-23
gi|5803135|ref|NP_006852.1| RAB35, member RAS oncogene family; r... 111 1e-23
gi|49901476|gb|AAH76437.1| Zgc:100889 protein [Danio rerio] 111 1e-23
gi|34784624|gb|AAH57747.1| MGC69101 protein [Xenopus laevis] 111 1e-23
gi|50539696|ref|NP_001002318.1| zgc:86635 [Danio rerio] >gnl|BL_... 110 1e-23
gi|10120632|pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium ... 110 1e-23
gi|38194437|gb|AAR13228.1| Rab family GTPase Rab8 [Fucus distichus] 110 1e-23
gi|50756687|ref|XP_415275.1| PREDICTED: similar to RAB35 protein... 110 1e-23
gi|466170|sp|P16976|YPT1_MAIZE GTP-binding protein YPTM1 >gnl|BL... 110 1e-23
gi|20071543|gb|AAH26915.1| Rab6 protein [Mus musculus] 110 1e-23
gi|7533034|gb|AAF63333.1| YptA [Aspergillus awamori] 110 1e-23
gi|32401324|gb|AAP80834.1| GTP-binding protein [Griffithsia japo... 110 1e-23
gi|20129057|ref|NP_608373.1| CG9575-PA [Drosophila melanogaster]... 110 2e-23
gi|50553762|ref|XP_504292.1| YlRYL1 [Yarrowia lipolytica] >gnl|B... 110 2e-23
gi|29841143|gb|AAP06156.1| similar to NM_070996 RAS-related prot... 110 2e-23
gi|6984166|gb|AAF34783.1| RAB6 protein [Toxoplasma gondii] 110 3e-23
gi|1613773|gb|AAB16753.1| Rab1 110 3e-23
gi|37546274|ref|XP_293398.2| similar to DNA segment, Chr 9, Brig... 110 3e-23
gi|34901804|ref|NP_912248.1| GTP-binding protein Rab6 [Oryza sat... 110 3e-23
gi|2133238|pir||S51495 GTP-binding protein RYL1 - yeast (Yarrowi... 110 3e-23
gi|2623643|gb|AAB86480.1| GTP-binding protein [Entamoeba histoly... 109 3e-23
gi|47217560|emb|CAG02487.1| unnamed protein product [Tetraodon n... 109 3e-23
gi|46249671|gb|AAH68969.1| RAB35 protein [Xenopus laevis] 109 3e-23
gi|47225130|emb|CAF98757.1| unnamed protein product [Tetraodon n... 109 3e-23
gi|32492052|gb|AAP85298.1| Rab2 [Babesia bovis] 109 3e-23
gi|32398960|emb|CAD98425.1| rab1a protein, probable [Cryptospori... 109 3e-23
gi|13537429|dbj|BAB40669.1| small GTPase Rab1 [Entamoeba histoly... 109 3e-23
gi|27469883|gb|AAH41759.1| RAB35 protein [Xenopus laevis] 109 3e-23
gi|7677422|gb|AAF67162.1| GTPase Rab37 [Mus musculus] >gnl|BL_OR... 109 4e-23
gi|17555956|ref|NP_499454.1| RAB family member (23.4 kD) (rab-35... 109 4e-23
gi|103724|pir||B38625 GTP-binding protein ora2 - electric ray (D... 109 4e-23
gi|8394124|ref|NP_059055.1| ras-related protein rab10 [Rattus no... 109 4e-23
gi|15229836|ref|NP_187779.1| Ras-related GTP-binding protein, pu... 109 4e-23
gi|39595692|emb|CAE67195.1| Hypothetical protein CBG12631 [Caeno... 109 4e-23
gi|17509233|ref|NP_491857.1| RAB family member (22.7 kD) (rab-10... 109 4e-23
gi|50292669|ref|XP_448767.1| unnamed protein product [Candida gl... 108 6e-23
gi|1053065|gb|AAA80679.1| small GTP-binding protein 108 6e-23
gi|39597850|emb|CAE68542.1| Hypothetical protein CBG14372 [Caeno... 108 6e-23
gi|39584751|emb|CAE67646.1| Hypothetical protein CBG13205 [Caeno... 108 6e-23
gi|50424201|ref|XP_460687.1| unnamed protein product [Debaryomyc... 108 6e-23
gi|3334326|sp|O14462|SEC4_CANAL Ras-related protein SEC4 >gnl|BL... 108 6e-23
gi|50404947|ref|YP_054039.1| Ras-related RAB, putative [Parameci... 108 6e-23
gi|15489394|gb|AAH13790.1| Rab15 protein [Mus musculus] 108 6e-23
gi|50756625|ref|XP_415245.1| PREDICTED: similar to RAB36, member... 108 7e-23
gi|31795535|ref|NP_004905.2| RAB36, member RAS oncogene family; ... 108 7e-23
gi|4579755|dbj|BAA75195.1| small GTP-binding protein Rab36 [Homo... 108 7e-23
gi|23479748|gb|EAA16491.1| putative GTPase [Plasmodium yoelii yo... 108 7e-23
gi|20139581|sp|Q96AX2|RB37_HUMAN Ras-related protein Rab-37 >gnl... 108 1e-22
gi|464532|sp|P34143|RABC_DICDI Ras-related protein RabC >gnl|BL_... 108 1e-22
gi|28572143|ref|NP_524432.4| CG3320-PB [Drosophila melanogaster]... 108 1e-22
gi|31205793|ref|XP_311848.1| ENSANGP00000018202 [Anopheles gambi... 107 1e-22
gi|31201759|ref|XP_309827.1| ENSANGP00000018266 [Anopheles gambi... 107 1e-22
gi|48103608|ref|XP_392879.1| similar to ENSANGP00000012769 [Apis... 107 1e-22
gi|1546067|gb|AAB08102.1| GTPase SUrab10p [Strongylocentrotus pu... 107 1e-22
gi|38103716|gb|EAA50384.1| hypothetical protein MG04143.4 [Magna... 107 1e-22
gi|47223089|emb|CAG07176.1| unnamed protein product [Tetraodon n... 107 1e-22
gi|14318480|ref|NP_116615.1| Ras-like small GTPase, involved in ... 107 2e-22
gi|4293|emb|CAA25036.1| unnamed protein product [Saccharomyces c... 107 2e-22
gi|29841055|gb|AAP06068.1| similar to GenBank Accession Number S... 107 2e-22
gi|349484|gb|AAA18826.1| GTP-binding protein homologue 107 2e-22
gi|464530|sp|P34141|RABA_DICDI Ras-related protein RabA >gnl|BL_... 107 2e-22
gi|39645075|gb|AAH63736.1| MGC68722 protein [Xenopus laevis] 106 3e-22
gi|17555898|ref|NP_499328.1| RAB family member (rab-30) [Caenorh... 106 3e-22
gi|39591868|emb|CAE71446.1| Hypothetical protein CBG18357 [Caeno... 106 3e-22
gi|33416686|gb|AAH56054.1| MGC69017 protein [Xenopus laevis] 106 3e-22
gi|29841343|gb|AAP06375.1| similar to NM_130025 putative small G... 106 3e-22
gi|31543568|ref|NP_067386.2| RAB37, member of RAS oncogene famil... 106 4e-22
gi|6320869|ref|NP_010948.1| probably involved in intra-Golgi tra... 106 4e-22
gi|33944327|ref|XP_340311.1| small GTP binding protein RAB6, put... 106 4e-22
gi|13537449|dbj|BAB40679.1| small GTPase Rab11C [Entamoeba histo... 106 4e-22
gi|42733994|gb|AAM33191.3| similar to Dictyostelium discoideum (... 106 4e-22
gi|4758986|ref|NP_004209.1| RAB11B, member RAS oncogene family; ... 106 4e-22
gi|7438439|pir||T07609 GTP-binding protein SYPT - soybean >gnl|B... 106 4e-22
gi|47217979|emb|CAG02262.1| unnamed protein product [Tetraodon n... 105 5e-22
gi|10129780|emb|CAC08198.1| putative GTP-binding protein [Kluyve... 105 5e-22
gi|34849826|gb|AAH58382.1| RAB2, member RAS oncogene family [Mus... 105 5e-22
gi|26341800|dbj|BAC34562.1| unnamed protein product [Mus musculus] 105 5e-22
gi|39596714|emb|CAE63333.1| Hypothetical protein CBG07733 [Caeno... 105 5e-22
gi|50540176|ref|NP_001002555.1| zgc:92772 [Danio rerio] >gnl|BL_... 105 5e-22
gi|47216427|emb|CAG01978.1| unnamed protein product [Tetraodon n... 105 5e-22
gi|131849|sp|P22129|R11B_DISOM Ras-related protein Rab-11B (ORA3... 105 5e-22
gi|31324876|gb|AAP48704.1| rab11-2 [Limulus polyphemus] 105 5e-22
gi|50760924|ref|XP_418183.1| PREDICTED: similar to GTP-binding p... 105 5e-22
gi|38303826|gb|AAH61984.1| Rab26 protein [Rattus norvegicus] 105 5e-22
gi|19920864|ref|NP_609094.1| CG9100-PB [Drosophila melanogaster]... 105 6e-22
gi|49256207|gb|AAH74233.1| RAB18 protein [Xenopus laevis] 105 6e-22
gi|10047431|gb|AAG12239.1| guanine nucleotide-binding protein Ra... 105 6e-22
gi|27882648|gb|AAH43996.1| RAB18 protein [Xenopus laevis] 105 6e-22
gi|34859460|ref|XP_344926.1| similar to RAB6, member RAS oncogen... 105 6e-22
gi|14249144|ref|NP_116006.1| RAB11B, member RAS oncogene family ... 105 6e-22
gi|49456343|emb|CAG46492.1| RAB11B [Homo sapiens] 105 6e-22
gi|50285709|ref|XP_445283.1| unnamed protein product [Candida gl... 105 6e-22
gi|6679583|ref|NP_033023.1| RAB11B, member RAS oncogene family [... 105 6e-22
gi|49671143|gb|AAH75268.1| Unknown (protein for MGC:88884) [Xeno... 105 6e-22
gi|24649793|ref|NP_733043.1| CG31118-PA [Drosophila melanogaster... 105 6e-22
gi|31241057|ref|XP_320947.1| ENSANGP00000017643 [Anopheles gambi... 105 6e-22
gi|7144601|gb|AAF37308.1| RabB [Entamoeba histolytica] 105 6e-22
gi|3273209|dbj|BAA31150.1| Rab1C [Dictyostelium discoideum] 105 6e-22
gi|23619044|ref|NP_705006.1| Rab5B protein [Plasmodium falciparu... 105 8e-22
gi|49084594|ref|XP_404484.1| hypothetical protein AN0347.2 [Aspe... 105 8e-22
gi|31208277|ref|XP_313105.1| ENSANGP00000012897 [Anopheles gambi... 105 8e-22
gi|49093036|ref|XP_407979.1| conserved hypothetical protein [Asp... 105 8e-22
gi|28497656|ref|XP_125709.2| RAB36, member RAS oncogene family [... 105 8e-22
gi|34068436|gb|AAQ56773.1| ras-related GTP-binding protein Rab18... 105 8e-22
gi|464525|sp|P34140|RB1B_DICDI Ras-related protein Rab1B >gnl|BL... 105 8e-22
gi|50370256|gb|AAH76054.1| Unknown (protein for MGC:92523) [Dani... 104 1e-21
gi|17568765|ref|NP_510572.1| RAB family member (23.4 kD) (rab-14... 104 1e-21
gi|19114819|ref|NP_593907.1| endocytic rab protein [Schizosaccha... 104 1e-21
gi|47550807|ref|NP_999935.1| zgc:55760 [Danio rerio] >gnl|BL_ORD... 104 1e-21
gi|49257826|gb|AAH74632.1| Unknown (protein for MGC:69558) [Xeno... 104 1e-21
gi|49257196|gb|AAH71068.1| Unknown (protein for MGC:78967) [Xeno... 104 1e-21
gi|106185|pir||B34323 GTP-binding protein Rab2 - human >gnl|BL_O... 104 1e-21
gi|27370881|gb|AAH41250.1| Rab11b-prov protein [Xenopus laevis] 104 1e-21
gi|49168476|emb|CAG38733.1| RAB11B [Homo sapiens] 104 1e-21
gi|1588651|prf||2209256A rab2 gene 104 1e-21
gi|4506365|ref|NP_002856.1| RAB2, member RAS oncogene family [Ho... 104 1e-21
gi|10946940|ref|NP_067493.1| RAB2, member RAS oncogene family; G... 104 1e-21
gi|41393075|ref|NP_958862.1| RAB2, member RAS oncogene family [D... 104 1e-21
gi|266878|sp|Q01971|RB2A_RABIT Ras-related protein Rab-2A >gnl|B... 104 1e-21
gi|45382561|ref|NP_990559.1| GTP-binding protein [Gallus gallus]... 104 1e-21
gi|5738170|gb|AAD50282.1| putative intermediate compartment prot... 104 1e-21
gi|50731391|ref|XP_417254.1| PREDICTED: similar to RAB6A, member... 104 1e-21
gi|26335369|dbj|BAC31385.1| unnamed protein product [Mus musculus] 103 2e-21
gi|50547479|ref|XP_501209.1| hypothetical protein [Yarrowia lipo... 103 2e-21
gi|49258038|gb|AAH74344.1| Unknown (protein for MGC:84182) [Xeno... 103 2e-21
gi|26892279|gb|AAN86142.1| RAB2B [Homo sapiens] 103 2e-21
gi|21361884|ref|NP_116235.2| RAB2B protein; RAS family, member R... 103 2e-21
gi|3025293|sp|Q39572|YPT6_CHLRE Ras-related protein YPTC6 >gnl|B... 103 2e-21
gi|38082075|ref|XP_283428.2| RAB26, member RAS oncogene family [... 103 2e-21
gi|46361978|ref|NP_055168.2| RAB26, member RAS oncogene family [... 103 2e-21
gi|44890744|gb|AAH66913.1| RAB26, member RAS oncogene family [Ho... 103 2e-21
gi|19921534|ref|NP_609966.1| CG9994-PA [Drosophila melanogaster]... 103 2e-21
gi|7438400|pir||T12437 small GTP-binding protein - common ice pl... 103 2e-21
gi|33873723|gb|AAH07681.2| RAB26 protein [Homo sapiens] 103 2e-21
gi|39586261|emb|CAE66672.1| Hypothetical protein CBG12011 [Caeno... 103 2e-21
gi|47216652|emb|CAG04850.1| unnamed protein product [Tetraodon n... 103 2e-21
gi|46436432|gb|EAK95794.1| hypothetical protein CaO19.2245 [Cand... 103 2e-21
gi|420270|pir||C42148 GTP-binding protein rab12 - rat (fragment) 103 2e-21
gi|24639915|ref|NP_524744.2| CG3129-PA [Drosophila melanogaster]... 103 2e-21
gi|28556900|dbj|BAC57527.1| GTP-binding protein rab-2 homologue ... 103 2e-21
gi|27806111|ref|NP_776871.1| RAB3A, member RAS oncogene family [... 103 2e-21
gi|47216650|emb|CAG04848.1| unnamed protein product [Tetraodon n... 103 2e-21
gi|19173266|ref|NP_597069.1| RAS-RELATED PROTEIN GTP-BINDING PRO... 103 3e-21
gi|50755689|ref|XP_414855.1| PREDICTED: similar to RAB26, member... 103 3e-21
gi|38102602|gb|EAA49421.1| hypothetical protein MG01079.4 [Magna... 103 3e-21
gi|17507539|ref|NP_491233.1| RAB family member (23.6 kD) (rab-2)... 103 3e-21
gi|13509187|emb|CAB92946.2| putative Rab7 GTPase [Plasmodium fal... 103 3e-21
gi|13785146|emb|CAA72626.2| rab4A-like protein [Trichinella pseu... 103 3e-21
gi|6517192|dbj|BAA87878.1| Drab2 [Drosophila melanogaster] 103 3e-21
gi|464555|sp|P35284|RB12_RAT Ras-related protein Rab-12 >gnl|BL_... 103 3e-21
gi|50420081|ref|XP_458573.1| unnamed protein product [Debaryomyc... 103 3e-21
gi|7438428|pir||T06443 GTP-binding protein - garden pea >gnl|BL_... 103 3e-21
gi|13929006|ref|NP_113906.1| RAB2, member RAS oncogene family [R... 103 3e-21
gi|5926718|dbj|BAA84640.1| PRA2 [Pisum sativum] 102 4e-21
gi|45592944|ref|NP_996661.1| Unknown (protein for MGC:77145); wu... 102 4e-21
gi|31745716|gb|AAP57202.1| Rab11 [Toxoplasma gondii] 102 4e-21
gi|23484033|gb|EAA19507.1| small GTPase rab11-related [Plasmodiu... 102 4e-21
gi|14423577|gb|AAK62471.1| small GTP-binding protein Rab8 [Entam... 102 4e-21
gi|7438429|pir||T06444 GTP-binding protein - garden pea (fragmen... 102 4e-21
gi|27685547|ref|XP_237326.1| similar to Rab18 [Rattus norvegicus] 102 4e-21
gi|49069954|ref|XP_399266.1| hypothetical protein UM01651.1 [Ust... 102 4e-21
gi|32451720|gb|AAH54719.1| Unknown (protein for MGC:64765) [Mus ... 102 4e-21
gi|30525051|ref|NP_766189.1| RAB2B protein [Mus musculus] >gnl|B... 102 4e-21
gi|27675132|ref|XP_223991.1| similar to Ras-related protein Rab-... 102 4e-21
gi|23619155|ref|NP_705117.1| small GTPase Rab11 [Plasmodium falc... 102 4e-21
gi|28376635|ref|NP_783865.1| RAB37, member RAS oncogene family; ... 102 4e-21
gi|26337951|dbj|BAC32661.1| unnamed protein product [Mus musculus] 102 4e-21
gi|464526|sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 >gnl|BL... 102 4e-21
gi|47223036|emb|CAG07123.1| unnamed protein product [Tetraodon n... 102 5e-21
gi|50753230|ref|XP_413914.1| PREDICTED: similar to RAB11a, membe... 102 5e-21
gi|13537447|dbj|BAB40678.1| small GTPase Rab11B [Entamoeba histo... 102 5e-21
gi|1619851|gb|AAB16971.1| rab8-like [Caenorhabditis elegans] 102 5e-21
gi|50540122|ref|NP_001002530.1| zgc:92916 [Danio rerio] >gnl|BL_... 102 5e-21
gi|18376163|emb|CAD21237.1| probable GTP-binding protein Drab11 ... 102 5e-21
gi|2463536|dbj|BAA22522.1| GTP binding protein [Rattus norvegicus] 102 5e-21
gi|30584069|gb|AAP36283.1| Homo sapiens RAB11A, member RAS oncog... 102 5e-21
gi|464565|sp|Q05976|RB18_LYMST Ras-related protein Rab-18A >gnl|... 102 5e-21
gi|31212835|ref|XP_315402.1| ENSANGP00000020903 [Anopheles gambi... 102 5e-21
gi|19424272|ref|NP_598264.1| RAB26, member RAS oncogene family [... 102 5e-21
gi|17137088|ref|NP_477090.1| CG3269-PA [Drosophila melanogaster]... 102 5e-21
gi|34897394|ref|NP_910043.1| Ras-related GTP-binding protein [Or... 102 5e-21
gi|4758984|ref|NP_004654.1| Ras-related protein Rab-11A; RAB 11A... 102 5e-21
gi|7508349|pir||T28972 hypothetical protein T23H2.6 - Caenorhabd... 102 5e-21
gi|7108528|gb|AAF36458.1| small GTPase [Mus musculus] 102 5e-21
gi|42543202|pdb|1OIV|A Chain A, X-Ray Structure Of The Small G P... 102 5e-21
gi|14149799|ref|NP_115520.1| RAB6C, member RAS oncogene family [... 102 7e-21
gi|5738168|gb|AAD50281.1| putative intermediate compartment prot... 102 7e-21
gi|50751596|ref|XP_422470.1| PREDICTED: similar to RAB3C, member... 102 7e-21
gi|41469625|gb|AAS07348.1| putative GTP-binding protein [Oryza s... 102 7e-21
gi|27687387|ref|XP_225453.1| similar to Rab18 [Rattus norvegicus] 102 7e-21
gi|6755258|ref|NP_035355.1| RAB18, member RAS oncogene family [M... 102 7e-21
gi|10880989|ref|NP_067075.1| RAB18, member RAS oncogene family; ... 102 7e-21
gi|18410144|ref|NP_567008.1| Rab GTPase (ARA6) [Arabidopsis thal... 102 7e-21
gi|6324236|ref|NP_014306.1| Involved in vacuolar protein sorting... 102 7e-21
gi|46561764|gb|AAT01087.1| putative rab11 [Homalodisca coagulata] 102 7e-21
gi|542218|pir||A47733 GTP-binding protein ypt5 - fission yeast ... 101 9e-21
gi|47216418|emb|CAG01969.1| unnamed protein product [Tetraodon n... 101 9e-21
gi|31216369|ref|XP_316217.1| ENSANGP00000005948 [Anopheles gambi... 101 9e-21
gi|37788825|gb|AAP51290.1| Rab11-1a [Limulus polyphemus] >gnl|BL... 101 9e-21
gi|19880892|gb|AAM00540.1| YPT53 [Saccharomyces cerevisiae] >gnl... 101 9e-21
gi|548666|sp|P36410|RAB4_DICDI Ras-related protein Rab4 >gnl|BL_... 101 1e-20
gi|19114579|ref|NP_593667.1| YPT1-related rab subfamily protein ... 101 1e-20
gi|37788823|gb|AAP51289.1| Rab11-1c [Limulus polyphemus] 101 1e-20
gi|17647849|ref|NP_523777.1| CG4921-PB [Drosophila melanogaster]... 101 1e-20
gi|31980838|ref|NP_058595.2| RAB25, member RAS oncogene family [... 101 1e-20
gi|1083775|pir||JC2528 GTP-binding protein Rab26 - rat 101 1e-20
gi|7689363|gb|AAF67748.1| GTP-binding protein RAB3A [Homo sapiens] 101 1e-20
gi|50370044|gb|AAH75980.1| Unknown (protein for MGC:92276) [Dani... 101 1e-20
gi|6808528|gb|AAF28422.1| Rab6-like protein [Homo sapiens] 101 1e-20
gi|48095308|ref|XP_392276.1| similar to CG7605-PA [Apis mellifera] 100 2e-20
gi|17559534|ref|NP_507083.1| GTP-binding protein like (5Q673) [C... 100 2e-20
gi|15230422|ref|NP_187823.1| Ras-related GTP-binding family prot... 100 2e-20
gi|31199873|ref|XP_308884.1| ENSANGP00000012769 [Anopheles gambi... 100 2e-20
gi|17137216|ref|NP_477170.1| CG5771-PB [Drosophila melanogaster]... 100 2e-20
gi|48101226|ref|XP_392651.1| similar to ENSANGP00000020903 [Apis... 100 2e-20
gi|39597496|emb|CAE59726.1| Hypothetical protein CBG03162 [Caeno... 100 2e-20
gi|21217443|gb|AAM33785.1| Rab11 [Periplaneta americana] 100 2e-20
gi|45934561|gb|AAS79340.1| RAB-like GTP binding protein [Aedes a... 100 2e-20
gi|6679593|ref|NP_033027.1| RAB3A, member RAS oncogene family [M... 100 2e-20
gi|4506367|ref|NP_002857.1| RAB3A, member RAS oncogene family; R... 100 2e-20
gi|6981452|ref|NP_037150.1| RAB3A, member RAS oncogene family; R... 100 2e-20
gi|89582|pir||A29224 GTP-binding protein smg-25A - bovine 100 2e-20
gi|1405561|emb|CAA67153.1| FSGTP1 [Fagus sylvatica] 100 2e-20
gi|50557054|ref|XP_505935.1| hypothetical protein [Yarrowia lipo... 100 2e-20
gi|1016750|gb|AAA79138.1| rab-related GTP-binding protein 100 2e-20
gi|31227871|ref|XP_317956.1| ENSANGP00000022790 [Anopheles gambi... 100 2e-20
gi|30923578|gb|EAA46055.1| CG17515-PB [Drosophila melanogaster] 100 2e-20
gi|48096697|ref|XP_392500.1| similar to Ras-related protein Rab-... 100 2e-20
gi|21429138|gb|AAM50288.1| RE42508p [Drosophila melanogaster] 100 2e-20
gi|3024500|sp|Q40191|R11A_LOTJA Ras-related protein Rab11A >gnl|... 100 2e-20
gi|32414965|ref|XP_327962.1| hypothetical protein ( (NM_017382) ... 100 2e-20
gi|25012906|gb|AAN71540.1| RH21315p [Drosophila melanogaster] 100 2e-20
gi|548673|sp|P36412|RB11_DICDI Ras-related protein Rab11 >gnl|BL... 100 2e-20
gi|28828965|gb|AAO51546.1| similar to RAS-related protein [Caeno... 100 2e-20
gi|2313043|dbj|BAA21710.1| rab-related protein 4 [Drosophila mel... 100 2e-20
gi|4930237|pdb|3RAB|A Chain A, Gppnhp-Bound Rab3a At 2.0 A Resol... 100 2e-20
gi|46577690|sp|P35283|RB12_MOUSE Ras-related protein Rab-12 (Rab... 100 2e-20
gi|50556440|ref|XP_505628.1| hypothetical protein [Yarrowia lipo... 100 3e-20
gi|50732331|ref|XP_418585.1| PREDICTED: similar to Rab18 [Gallus... 100 3e-20
gi|47217500|emb|CAG10880.1| unnamed protein product [Tetraodon n... 100 3e-20
gi|7438434|pir||T06736 GTP-binding protein F28P10.180 - Arabidop... 100 3e-20
gi|1619853|gb|AAB16972.1| rab10-like [Caenorhabditis elegans] 100 3e-20
gi|39595276|emb|CAE60313.1| Hypothetical protein CBG03904 [Caeno... 100 3e-20
gi|19923985|ref|NP_612462.1| RAB3C, member RAS oncogene family [... 100 3e-20
gi|89584|pir||C29224 GTP-binding protein smg-25C - bovine 100 3e-20
gi|19424194|ref|NP_598220.1| RAB3C, member RAS oncogene family [... 100 3e-20
gi|21361509|ref|NP_057238.2| ras-related GTP-binding protein 4b ... 100 3e-20
gi|1370180|emb|CAA98167.1| RAB5B [Lotus corniculatus var. japoni... 100 3e-20
gi|48103887|ref|XP_392903.1| similar to RAB18, member RAS oncoge... 100 3e-20
gi|49070122|ref|XP_399350.1| hypothetical protein UM01735.1 [Ust... 100 3e-20
gi|33150586|gb|AAP97171.1| rab4b [Homo sapiens] 100 3e-20
gi|50258123|gb|EAL20817.1| hypothetical protein CNBE1790 [Crypto... 100 3e-20
gi|46577634|sp|P61017|RB4B_CANFA Ras-related protein Rab-4B >gnl... 100 3e-20
gi|15986733|gb|AAL11725.1| GTP-binding protein RAB4 [Mus musculus] 100 3e-20
gi|8394136|ref|NP_059051.1| ras-related GTP-binding protein 4b [... 100 3e-20
gi|12230537|sp|Q9ULW5|RB26_HUMAN Ras-related protein Rab-26 >gnl... 100 3e-20
gi|1845598|gb|AAB47925.1| Rab3 [Loligo pealei] 100 3e-20
gi|50540426|ref|NP_001002679.1| zgc:86892 [Danio rerio] >gnl|BL_... 100 3e-20
gi|50582491|dbj|BAD32700.1| Rab3 [Loligo pealei] 100 3e-20
gi|31209781|ref|XP_313857.1| ENSANGP00000024287 [Anopheles gambi... 100 3e-20
gi|12837642|dbj|BAB23894.1| unnamed protein product [Mus musculus] 100 3e-20
gi|5738166|gb|AAD50280.1| putative intermediate compartment prot... 100 3e-20
gi|38109382|gb|EAA55263.1| hypothetical protein MG06920.4 [Magna... 100 3e-20
gi|283769|pir||A43958 GTP-binding protein, synaptic vesicle spec... 100 3e-20
gi|15230211|ref|NP_188512.1| Ras-related GTP-binding protein, pu... 100 3e-20
gi|400923|sp|P31022|RAB7_PEA Ras-related protein Rab7 >gnl|BL_OR... 100 3e-20
gi|1370144|emb|CAA98178.1| RAB11B [Lotus corniculatus var. japon... 100 3e-20
gi|32409189|ref|XP_325075.1| hypothetical protein [Neurospora cr... 100 3e-20
gi|42543204|pdb|1OIW|A Chain A, X-Ray Structure Of The Small G P... 100 3e-20
>gi|17556434|ref|NP_497608.1| GTP-binding protein like (22.2 kD)
(3D822) [Caenorhabditis elegans]
gi|13559778|gb|AAK29982.1| Hypothetical protein Y71H2AM.12
[Caenorhabditis elegans]
Length = 195
Score = 392 bits (1006), Expect = e-108
Identities = 195/195 (100%), Positives = 195/195 (100%)
Frame = -1
Query: 588 MDTIKTVKVVVVGESGAGKTALLTCFLDNTFETDPLTTIGIDFKHKIVQLNDGQSIRLQL 409
MDTIKTVKVVVVGESGAGKTALLTCFLDNTFETDPLTTIGIDFKHKIVQLNDGQSIRLQL
Sbjct: 1 MDTIKTVKVVVVGESGAGKTALLTCFLDNTFETDPLTTIGIDFKHKIVQLNDGQSIRLQL 60
Query: 408 WDTAGQERFRQLAPAYIRSARVALLVIDLSDENCVEHLIRWKGIIDKNKSDFTSTIIVGN 229
WDTAGQERFRQLAPAYIRSARVALLVIDLSDENCVEHLIRWKGIIDKNKSDFTSTIIVGN
Sbjct: 61 WDTAGQERFRQLAPAYIRSARVALLVIDLSDENCVEHLIRWKGIIDKNKSDFTSTIIVGN 120
Query: 228 KHDLVSEKRSPRLTAIIRETNDEYIETSAKMRKNIKKLFSSVACRPFPEHETSQIILLNE 49
KHDLVSEKRSPRLTAIIRETNDEYIETSAKMRKNIKKLFSSVACRPFPEHETSQIILLNE
Sbjct: 121 KHDLVSEKRSPRLTAIIRETNDEYIETSAKMRKNIKKLFSSVACRPFPEHETSQIILLNE 180
Query: 48 PRPVESATKRCCQRW 4
PRPVESATKRCCQRW
Sbjct: 181 PRPVESATKRCCQRW 195