Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y71H2B_3
(1221 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17556474|ref|NP_497585.1| guanine nucleotide binding protein ... 815 0.0
gi|39590618|emb|CAE64988.1| Hypothetical protein CBG09823 [Caeno... 694 0.0
gi|585190|sp|P38410|GBQ_XENLA Guanine nucleotide-binding protein... 91 7e-17
gi|214188|gb|AAA49730.1| GTP-binding protein 91 7e-17
gi|630961|pir||S45699 GTP-binding regulatory protein alpha chain... 89 2e-16
gi|9296968|sp|P82471|GBQ_RAT Guanine nucleotide-binding protein ... 88 4e-16
gi|13591957|ref|NP_112298.1| heterotrimeric guanine nucleotide-b... 88 4e-16
gi|585189|sp|P21279|GBQ_MOUSE Guanine nucleotide-binding protein... 88 5e-16
gi|71924|pir||RGMSQ GTP-binding regulatory protein Gq alpha chai... 88 5e-16
gi|304324|gb|AAA28060.1| G protein alpha subunit 88 5e-16
gi|25145853|ref|NP_740789.1| G protein, class Q, Alpha subunit, ... 88 5e-16
gi|37059806|ref|NP_032165.2| guanine nucleotide binding protein,... 88 5e-16
gi|2494885|sp|Q28294|GBQ_CANFA Guanine nucleotide-binding protei... 87 6e-16
gi|40254462|ref|NP_002063.2| guanine nucleotide binding protein ... 87 6e-16
gi|7441570|pir||S71963 GTP-binding protein alpha-q - human (frag... 87 6e-16
gi|1174072|gb|AAB06875.1| G alpha-q 87 8e-16
gi|1181671|gb|AAC50363.1| GTP-binding protein alpha q subunit >g... 87 1e-15
gi|6016103|sp|O73819|GB14_XENLA Guanine nucleotide-binding prote... 86 1e-15
gi|45383662|ref|NP_989565.1| guanine nucleotide binding protein ... 86 2e-15
gi|50761810|ref|XP_424845.1| PREDICTED: similar to Guanine nucle... 86 2e-15
gi|15029890|gb|AAH11169.1| Guanine nucleotide binding protein, a... 85 3e-15
gi|27805885|ref|NP_776748.1| guanine nucleotide binding protein ... 85 3e-15
gi|39589436|emb|CAE74465.1| Hypothetical protein CBG22211 [Caeno... 85 3e-15
gi|2286213|gb|AAB64301.1| GTP-binding protein alpha q [Homo sapi... 85 4e-15
gi|20073277|gb|AAH27015.1| Guanine nucleotide binding protein, a... 84 5e-15
gi|232137|sp|P30677|GB14_MOUSE Guanine nucleotide-binding protei... 84 5e-15
gi|31542895|ref|NP_032163.2| guanine nucleotide binding protein,... 84 5e-15
gi|4504037|ref|NP_002058.1| guanine nucleotide binding protein (... 84 7e-15
gi|4758444|ref|NP_004288.1| guanine nucleotide binding protein (... 84 7e-15
gi|17561828|ref|NP_505840.1| G Protein, Alpha subunit (40.7 kD) ... 84 7e-15
gi|1169854|sp|P43444|GB11_XENLA Guanine nucleotide-binding prote... 84 9e-15
gi|2286217|gb|AAB64303.1| guanine nucleotide binding protein alp... 83 1e-14
gi|3041682|sp|P29992|GB11_HUMAN Guanine nucleotide-binding prote... 83 1e-14
gi|20198865|gb|AAM15593.1| Egg laying defective protein 30, isof... 83 1e-14
gi|27503241|gb|AAH42284.1| Gna11-prov protein [Xenopus laevis] 83 1e-14
gi|27805795|ref|NP_776747.1| guanine nucleotide binding protein ... 82 2e-14
gi|6754004|ref|NP_034431.1| guanine nucleotide binding protein, ... 82 2e-14
gi|1169852|sp|P38409|GB11_BOVIN Guanine nucleotide-binding prote... 82 2e-14
gi|13591951|ref|NP_112295.1| guanine nucleotide-binding protein ... 82 2e-14
gi|50603860|gb|AAH77106.1| Unknown (protein for MGC:100897) [Dan... 82 2e-14
gi|17562782|ref|NP_506290.1| ODoRant response abnormal ODR-3, he... 82 3e-14
gi|1051238|gb|AAB36839.1| guanine nucleotide-binding protein 81 4e-14
gi|21483610|gb|AAM52780.1| SD21019p [Drosophila melanogaster] 81 6e-14
gi|30026270|gb|AAN78238.1| ODR-3 [Caenorhabditis elegans] 81 6e-14
gi|45361027|ref|NP_989150.1| Guanine nucleotide-binding protein,... 81 6e-14
gi|30026294|gb|AAN78250.1| ODR-3 [Caenorhabditis briggsae] >gnl|... 81 6e-14
gi|30026258|gb|AAN78232.1| ODR-3 [Caenorhabditis elegans] >gnl|B... 81 6e-14
gi|49227317|ref|NP_001001818.1| wu:fb10b04 [Danio rerio] >gnl|BL... 80 7e-14
gi|21263646|sp|O13055|GBI2_ORYLA Guanine nucleotide-binding prot... 80 1e-13
gi|50417122|gb|AAH77141.1| Unknown (protein for MGC:100942) [Dan... 80 1e-13
gi|17481207|dbj|BAB79199.1| G protein alpha subunit q class [Hal... 80 1e-13
gi|34861673|ref|XP_219671.2| similar to GTP-binding protein alph... 79 2e-13
gi|30026256|gb|AAN78231.1| ODR-3 [Caenorhabditis elegans] >gnl|B... 79 2e-13
gi|31218047|ref|XP_316554.1| ENSANGP00000010043 [Anopheles gambi... 79 2e-13
gi|26330604|dbj|BAC29032.1| unnamed protein product [Mus musculus] 79 2e-13
gi|30026254|gb|AAN78230.1| ODR-3 [Caenorhabditis elegans] >gnl|B... 79 2e-13
gi|1730209|sp|P54853|GBA1_CRYNE Guanine nucleotide-binding prote... 79 2e-13
gi|30026262|gb|AAN78234.1| ODR-3 [Caenorhabditis elegans] 79 2e-13
gi|17647455|ref|NP_523718.1| CG17759-PH [Drosophila melanogaster... 78 4e-13
gi|3913714|sp|P91950|GBQ_HOMAM Guanine nucleotide-binding protei... 78 4e-13
gi|30026274|gb|AAN78240.1| ODR-3 [Caenorhabditis remanei] >gnl|B... 78 4e-13
gi|30026290|gb|AAN78248.1| ODR-3 [Caenorhabditis remanei] 78 4e-13
gi|39591966|emb|CAE75186.1| Hypothetical protein CBG23127 [Caeno... 78 4e-13
gi|30026286|gb|AAN78246.1| ODR-3 [Caenorhabditis remanei] 78 4e-13
gi|30026280|gb|AAN78243.1| ODR-3 [Caenorhabditis remanei] 78 4e-13
gi|18654428|gb|AAL77635.1| guanine nucleotide binding protein [T... 78 5e-13
gi|14133505|gb|AAK54042.1| G protein alpha subunit 2 [Strongyloi... 78 5e-13
gi|34494848|dbj|BAC85104.1| Gq-like G protein alpha subunit [Bom... 77 6e-13
gi|1857923|gb|AAB48510.1| Gq protein alpha subunit [Limulus poly... 77 6e-13
gi|50256632|gb|EAL19355.1| hypothetical protein CNBH0490 [Crypto... 77 6e-13
gi|5670092|gb|AAD46575.1| G-protein alpha-subunit [Filobasidiell... 77 6e-13
gi|6625746|gb|AAF19378.1| Gq/11 protein alpha subunit [Panulirus... 77 8e-13
gi|30026276|gb|AAN78241.1| ODR-3 [Caenorhabditis remanei] 77 8e-13
gi|17540930|ref|NP_501921.1| G Protein, Alpha subunit (41.0 kD) ... 77 8e-13
gi|30026272|gb|AAN78239.1| ODR-3 [Caenorhabditis remanei] 77 8e-13
gi|45382313|ref|NP_990733.1| Gi2 protein alpha-subunit [Gallus g... 77 8e-13
gi|30026292|gb|AAN78249.1| ODR-3 [Caenorhabditis remanei] 77 8e-13
gi|30026296|gb|AAN78251.1| ODR-3 [Caenorhabditis briggsae] >gnl|... 77 1e-12
gi|17561830|ref|NP_505157.1| G Protein, Alpha subunit (41.5 kD) ... 76 1e-12
gi|39583722|emb|CAE63826.1| Hypothetical protein CBG08377 [Caeno... 76 1e-12
gi|183182|gb|AAA52556.1| guanine nucleotide-binding regulatory p... 76 1e-12
gi|45361345|ref|NP_989250.1| hypothetical protein MGC76300 [Xeno... 76 1e-12
gi|31214957|ref|XP_315935.1| ENSANGP00000013560 [Anopheles gambi... 76 1e-12
gi|585187|sp|P38412|GBQ_LOLFO Guanine nucleotide-binding protein... 76 1e-12
gi|3599503|gb|AAC35365.1| guanine nucleotide-binding protein Gi ... 76 2e-12
gi|19702253|gb|AAL93221.1| putative Gq protein alpha subunit [Ma... 76 2e-12
gi|30585131|gb|AAP36838.1| Homo sapiens guanine nucleotide bindi... 76 2e-12
gi|15779126|gb|AAH14627.1| Guanine nucleotide binding protein (G... 76 2e-12
gi|4504041|ref|NP_002061.1| guanine nucleotide binding protein (... 76 2e-12
gi|38505377|gb|AAQ74379.2| G-protein alpha subunit Gpa3 [Cryptoc... 76 2e-12
gi|39580185|emb|CAE71591.1| Hypothetical protein CBG18548 [Caeno... 76 2e-12
gi|41054141|ref|NP_956136.1| guanine nucleotide-binding protein ... 76 2e-12
gi|30315891|sp|Q9XZV4|GBQ_GEOCY Guanine nucleotide-binding prote... 75 2e-12
gi|39587877|emb|CAE67895.1| Hypothetical protein CBG13491 [Caeno... 75 3e-12
gi|1730227|sp|P38402|GBI2_CAVPO Guanine nucleotide-binding prote... 75 3e-12
gi|30026302|gb|AAN87175.1| ODR-3 [Caenorhabditis remanei] 75 4e-12
gi|7160789|emb|CAB76453.1| guanine nucleotide-binding protein al... 75 4e-12
gi|31209979|ref|XP_313956.1| ENSANGP00000025381 [Anopheles gambi... 75 4e-12
gi|5139711|dbj|BAA81699.1| G protein a subunit 3 [Ephydatia fluv... 75 4e-12
gi|348273|pir||S28158 GTP-binding regulatory protein Gi alpha-2 ... 75 4e-12
gi|23495476|dbj|BAC20192.1| G protein alpha subunit [Helicobasid... 74 5e-12
gi|42725849|gb|AAS38584.1| guanine nucleotide-binding protein G(... 74 5e-12
gi|6677598|gb|AAD26121.2| guanine nucleotide-binding protein Gi2... 74 5e-12
gi|24652446|ref|NP_724934.1| CG2204-PB [Drosophila melanogaster]... 74 5e-12
gi|31209983|ref|XP_313958.1| ENSANGP00000022606 [Anopheles gambi... 74 7e-12
gi|50257824|gb|EAL20525.1| hypothetical protein CNBE4450 [Crypto... 74 7e-12
gi|47223707|emb|CAF99316.1| unnamed protein product [Tetraodon n... 74 7e-12
gi|7415988|dbj|BAA93630.1| G protein alpha subunit [Halocynthia ... 74 7e-12
gi|120993|sp|P16051|GBA2_DICDI Guanine nucleotide-binding protei... 74 7e-12
gi|41387190|ref|NP_957081.1| guanine nucleotide binding protein ... 74 7e-12
gi|1346102|sp|P10825|GB0_XENLA Guanine nucleotide-binding protei... 74 7e-12
gi|2058390|emb|CAA60600.1| alpha 01 subunit of heterotrimeric GT... 74 7e-12
gi|71916|pir||RGFFO1 GTP-binding regulatory protein Go alpha cha... 74 7e-12
gi|71914|pir||RGXLOA GTP-binding regulatory protein Go alpha cha... 74 7e-12
gi|45382713|ref|NP_990022.1| rod-type transducin alpha subunit; ... 74 9e-12
gi|47225608|emb|CAG07951.1| unnamed protein product [Tetraodon n... 74 9e-12
gi|13591955|ref|NP_112297.1| GTP-binding protein (G-alpha-i2) [R... 74 9e-12
gi|47219923|emb|CAF97193.1| unnamed protein product [Tetraodon n... 73 1e-11
gi|26364567|dbj|BAB26258.2| unnamed protein product [Mus musculus] 73 1e-11
gi|21687052|ref|NP_610800.2| CG17760-PA [Drosophila melanogaster... 73 1e-11
gi|24652448|ref|NP_523684.2| CG2204-PA [Drosophila melanogaster]... 73 1e-11
gi|11037746|gb|AAG27721.1| heterotrimeric G protein alpha subuni... 73 2e-11
gi|71897|pir||RGMSI2 GTP-binding regulatory protein Gi alpha-2 c... 73 2e-11
gi|219669|dbj|BAA14180.1| Gx-alpha [Homo sapiens] 73 2e-11
gi|34860125|ref|XP_345272.1| similar to G-protein alpha-t2 subun... 73 2e-11
gi|103129|pir||JN0115 GTP-binding regulatory protein dgq alpha c... 73 2e-11
gi|47551303|ref|NP_999835.1| guanine nucleotide-binding protein ... 72 2e-11
gi|47226407|emb|CAG08423.1| unnamed protein product [Tetraodon n... 72 2e-11
gi|5566083|gb|AAD45319.1| heterotrimeric G protein alpha subunit... 72 2e-11
gi|6980966|ref|NP_037321.1| guanine nucleotide binding protein, ... 72 2e-11
gi|23336958|gb|AAH37333.1| Guanine nucleotide binding protein, a... 72 2e-11
gi|22711867|gb|AAM77353.2| visual iGq-alpha protein [Loligo pealei] 72 2e-11
gi|13195564|gb|AAK15759.1| G protein alpha-subunit [Pisolithus s... 72 2e-11
gi|24653117|ref|NP_725196.1| CG17759-PD [Drosophila melanogaster... 72 3e-11
gi|5139703|dbj|BAA81695.1| G protein a subunit 3 [Hydra magnipap... 72 3e-11
gi|41054806|ref|NP_032164.2| guanine nucleotide binding protein,... 72 3e-11
gi|585183|sp|P38400|GBI2_CANFA Guanine nucleotide-binding protei... 72 3e-11
gi|3023823|sp|O15976|GB0_PATYE Guanine nucleotide-binding protei... 72 3e-11
gi|6680043|ref|NP_032167.1| guanine nucleotide binding protein, ... 72 3e-11
gi|38079542|ref|XP_144196.2| similar to Guanine nucleotide-bindi... 72 3e-11
gi|34865915|ref|XP_343481.1| similar to Gnat1 protein [Rattus no... 72 3e-11
gi|50761818|ref|XP_429163.1| PREDICTED: similar to GTP-binding p... 72 3e-11
gi|6754010|ref|NP_034434.1| guanine nucleotide binding protein, ... 72 3e-11
gi|48479033|gb|AAT44837.1| heterotrimeric GTP-binding protein al... 72 3e-11
gi|1730229|sp|P08752|GBI2_MOUSE Guanine nucleotide-binding prote... 72 3e-11
gi|563253|gb|AAA67707.1| guanine nucleotide regulatory protein 72 3e-11
gi|27532946|ref|NP_034441.1| guanine nucleotide binding protein,... 72 3e-11
gi|585173|sp|P38404|GB0_LOCMI Guanine nucleotide-binding protein... 72 3e-11
gi|47219775|emb|CAG03402.1| unnamed protein product [Tetraodon n... 72 3e-11
gi|11559291|dbj|BAB18736.1| heterotrimeric G protein alpha subun... 72 3e-11
gi|11559293|dbj|BAB18737.1| heterotrimeric G protein alpha subun... 71 5e-11
gi|4504051|ref|NP_002064.1| guanine nucleotide binding protein, ... 71 5e-11
gi|24653121|ref|NP_725198.1| CG30054-PA [Drosophila melanogaster... 71 5e-11
gi|1730206|sp|P51877|GB0_HELTI Guanine nucleotide-binding protei... 71 5e-11
gi|47825400|ref|NP_001001475.1| guanine nucleotide-binding prote... 71 5e-11
gi|24653123|ref|NP_725199.1| CG30054-PB [Drosophila melanogaster... 71 5e-11
gi|49259163|pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of... 71 6e-11
gi|38488725|ref|NP_942100.1| guanine nucleotide binding protein ... 71 6e-11
gi|1730207|sp|P53359|GB0_MANSE Guanine nucleotide-binding protei... 71 6e-11
gi|23398623|gb|AAH16995.1| GNAI2 protein [Homo sapiens] 71 6e-11
gi|348272|pir||S28157 GTP-binding regulatory protein Gi alpha-1 ... 71 6e-11
gi|10567816|ref|NP_066268.1| guanine nucleotide binding protein ... 71 6e-11
gi|20072863|gb|AAH26326.1| Guanine nucleotide binding protein (G... 71 6e-11
gi|121021|sp|P27044|GBI1_XENLA Guanine nucleotide-binding protei... 71 6e-11
gi|27465609|ref|NP_775162.1| gustducin [Rattus norvegicus] >gnl|... 71 6e-11
gi|30794334|ref|NP_851365.1| guanine nucleotide binding protein ... 70 8e-11
gi|2293542|gb|AAB65425.1| MAGA [Magnaporthe grisea] 70 8e-11
gi|47524492|gb|AAT34978.1| guanine nucleotide-binding protein G(... 70 8e-11
gi|232136|sp|P30683|GB0_LYMST Guanine nucleotide-binding protein... 70 8e-11
gi|120977|sp|P17806|GB02_CRILO Guanine nucleotide-binding protei... 70 8e-11
gi|6680041|ref|NP_032166.1| guanine nucleotide binding protein, ... 70 1e-10
gi|1730225|sp|P38401|GBI1_CAVPO Guanine nucleotide-binding prote... 70 1e-10
gi|386750|gb|AAA52584.1| guanine nucleotide-binding protein [Hom... 70 1e-10
gi|3913723|sp|P87383|GBI1_ORYLA Guanine nucleotide-binding prote... 70 1e-10
gi|47225607|emb|CAG07950.1| unnamed protein product [Tetraodon n... 70 1e-10
gi|9489054|gb|AAB30632.2| G protein Gi2 alpha [Mus musculus] 70 1e-10
gi|1169866|sp|P41776|GBI_HOMAM Guanine nucleotide-binding protei... 70 1e-10
gi|41152264|ref|NP_957122.1| hypothetical protein MGC73153 [Dani... 70 1e-10
gi|17507897|ref|NP_492108.1| G protein, class O, Alpha subunit (... 70 1e-10
gi|28278608|gb|AAH44123.1| MGC53612 protein [Xenopus laevis] 70 1e-10
gi|27805887|ref|NP_776749.1| adenylate cyclase-inhibiting G alph... 70 1e-10
gi|50541890|gb|AAT78421.1| Galphai2 protein [Homo sapiens] 69 2e-10
gi|4504039|ref|NP_002059.1| guanine nucleotide binding protein (... 69 2e-10
gi|38110454|gb|EAA56167.1| hypothetical protein MG01818.4 [Magna... 69 2e-10
gi|120988|sp|P16894|GBA1_DICDI Guanine nucleotide-binding protei... 69 2e-10
gi|120998|sp|P27045|GBAK_XENLA Guanine nucleotide-binding protei... 69 2e-10
gi|33641702|gb|AAQ24336.1| G-alpha subunit [Penicillium marneffei] 69 2e-10
gi|47825398|ref|NP_001001474.1| guanine nucleotide-binding prote... 69 2e-10
gi|39594585|emb|CAE72163.1| Hypothetical protein CBG19263 [Caeno... 69 2e-10
gi|5650709|emb|CAB43212.2| hypothetical protein [Homo sapiens] 69 2e-10
gi|18249678|dbj|BAB83917.1| G protein alpha subunit Gi splicing ... 69 2e-10
gi|6980962|ref|NP_037277.1| guanine nucleotide binding protein, ... 69 2e-10
gi|17561832|ref|NP_505425.1| G Protein, Alpha subunit (40.6 kD) ... 69 2e-10
gi|3273566|gb|AAC24766.1| MOD-D; G alpha protein [Podospora anse... 69 2e-10
gi|585188|sp|P38411|GBQ_LYMST Guanine nucleotide-binding protein... 69 2e-10
gi|32408163|ref|XP_324563.1| GUANINE NUCLEOTIDE-BINDING PROTEIN ... 69 2e-10
gi|39583868|emb|CAE63958.1| Hypothetical protein CBG08544 [Caeno... 69 2e-10
gi|24415108|gb|AAN59790.1| trimeric G-protein alpha o subunit [S... 69 2e-10
gi|18249680|dbj|BAB83918.1| G protein alpha subunit Gi splicing ... 69 2e-10
gi|33563256|ref|NP_034436.1| guanine nucleotide binding protein,... 69 2e-10
gi|359|emb|CAA31391.1| unnamed protein product [Bos taurus] 69 2e-10
gi|47116940|sp|Q9TU29|GB15_RABIT Guanine nucleotide-binding prot... 69 3e-10
gi|2494884|sp|Q28300|GBT1_CANFA Guanine nucleotide-binding prote... 69 3e-10
gi|22027520|ref|NP_000163.2| guanine nucleotide binding protein,... 69 3e-10
gi|1942173|pdb|1GOT|A Chain A, Heterotrimeric Complex Of A Gt-Al... 69 3e-10
gi|42725833|gb|AAS38583.1| guanine nucleotide-binding protein G(... 69 3e-10
gi|3599501|gb|AAC35364.1| guanine nucleotide-binding protein G(O... 69 3e-10
gi|7416001|dbj|BAA93636.1| G protein alpha subunit i class [Octo... 69 3e-10
gi|156321|gb|AAA28061.1| G protein alpha subunit 69 3e-10
gi|37538718|ref|XP_294370.2| guanine nucleotide binding protein,... 68 4e-10
gi|3023865|sp|O15975|GBQ_PATYE Guanine nucleotide-binding protei... 68 4e-10
gi|386747|gb|AAA52581.1| guanine nucleotide-binding protein alph... 68 4e-10
gi|22382165|gb|AAH26342.1| Guanine nucleotide binding protein, a... 68 4e-10
gi|5729850|ref|NP_006487.1| guanine nucleotide binding protein (... 68 4e-10
gi|45382315|ref|NP_990734.1| Gi1 protein alpha-subunit [Gallus g... 68 4e-10
gi|71906|pir||RGBOO1 GTP-binding regulatory protein Go alpha cha... 68 4e-10
gi|120979|sp|P18873|GB02_MOUSE Guanine nucleotide-binding protei... 68 4e-10
gi|6980964|ref|NP_037238.1| guanine nucleotide binding protein, ... 68 4e-10
gi|41281685|ref|NP_620073.1| guanine nucleotide binding protein ... 68 4e-10
gi|20147683|gb|AAM12609.1| guanine nucleotide binding protein al... 68 4e-10
gi|27805889|ref|NP_776750.1| guanine nucleotide binding protein ... 68 4e-10
gi|21465862|pdb|1KJY|A Chain A, Crystal Structure Of Human G[alp... 68 4e-10
gi|5139721|dbj|BAA81704.1| G protein a subunit 8 [Ephydatia fluv... 68 5e-10
gi|18858763|ref|NP_571943.1| guanine nucleotide binding protein ... 68 5e-10
gi|2624610|pdb|1AS0| Gtp-Gamma-S Bound G42v Gia1 >gnl|BL_ORD_ID... 68 5e-10
gi|640425|pdb|1GIA| Gi Alpha 1 (Active Form With Bound Gtp-Gamm... 68 5e-10
gi|585191|sp|P38407|GBT_XENLA Guanine nucleotide-binding protein... 68 5e-10
gi|2494879|sp|P87032|GBA1_USTMA Guanine nucleotide-binding prote... 68 5e-10
gi|232149|sp|P30676|GBI_ASTPE Guanine nucleotide-binding protein... 68 5e-10
gi|3789978|gb|AAC67568.1| rod transducin alpha subunit [Ambystom... 67 7e-10
gi|49523123|gb|AAH75229.1| Unknown (protein for MGC:84417) [Xeno... 67 7e-10
gi|1345097|gb|AAC98513.1| guanine nucleotide binding protein alp... 67 7e-10
gi|8394152|ref|NP_059023.1| GTP-binding protein alpha o; GTP-bin... 67 7e-10
gi|47228773|emb|CAG07505.1| unnamed protein product [Tetraodon n... 67 7e-10
gi|13399564|pdb|1FQJ|A Chain A, Crystal Structure Of The Heterot... 67 7e-10
gi|232140|sp|P30675|GBA1_COPCO Guanine nucleotide-binding protei... 67 9e-10
gi|4456856|emb|CAB36912.1| G protein alpha subunit [Sclerotinia ... 67 9e-10
gi|39590325|emb|CAE66064.1| Hypothetical protein CBG11277 [Caeno... 67 9e-10
gi|20330805|ref|NP_005263.1| guanine nucleotide binding protein,... 67 9e-10
gi|6754012|ref|NP_034438.1| guanine nucleotide binding protein, ... 67 9e-10
gi|348274|pir||S28159 GTP-binding regulatory protein Gi alpha-3 ... 67 9e-10
gi|31865|emb|CAA33196.1| unnamed protein product [Homo sapiens] 67 1e-09
gi|50426093|ref|XP_461643.1| unnamed protein product [Debaryomyc... 67 1e-09
gi|15225278|ref|NP_180198.1| guanine nucleotide binding protein ... 67 1e-09
gi|3891516|pdb|1BH2| A326s Mutant Of An Inhibitory Alpha Subunit 67 1e-09
gi|25295772|pir||JC7662 G protein alpha subunit Rga3 protein - R... 67 1e-09
gi|1730212|sp|P38403|GBAK_CAVPO Guanine nucleotide-binding prote... 67 1e-09
gi|156319|gb|AAA28059.1| G-o protein alpha subunit 67 1e-09
gi|576308|pdb|1TND|A Chain A, Transducin (Alpha Subunit) Complex... 66 1e-09
gi|17298141|dbj|BAB78537.1| heterotrimeric G protein alpha subun... 66 1e-09
gi|1345099|gb|AAC49295.1| guanosine nucleotide binding protein a... 66 1e-09
gi|232135|sp|P30033|GB02_RAT Guanine nucleotide-binding protein ... 66 1e-09
gi|7416003|dbj|BAA93637.1| G protein a subunit o class [Octopus ... 66 1e-09
gi|39589328|emb|CAE74357.1| Hypothetical protein CBG22078 [Caeno... 66 2e-09
gi|47229779|emb|CAG06975.1| unnamed protein product [Tetraodon n... 66 2e-09
gi|6647521|sp|O74259|GBA1_SPOSC Guanine nucleotide-binding prote... 66 2e-09
gi|47216354|emb|CAG02412.1| unnamed protein product [Tetraodon n... 66 2e-09
gi|47219922|emb|CAF97192.1| unnamed protein product [Tetraodon n... 66 2e-09
gi|18654411|gb|AAL77627.1| G protein alpha subunit [Takifugu rub... 66 2e-09
gi|25012870|gb|AAN71523.1| RH09776p [Drosophila melanogaster] 65 2e-09
gi|12044824|emb|CAC19871.1| G protein alpha subunit [Botryotinia... 65 2e-09
gi|1814384|gb|AAB41887.1| transducin alpha subunit [Sparus aurata] 65 2e-09
gi|2494877|sp|Q00580|GBA1_CRYPA Guanine nucleotide-binding prote... 65 2e-09
gi|1942391|pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_... 65 2e-09
gi|17737609|ref|NP_524118.1| CG12232-PA [Drosophila melanogaster... 65 2e-09
gi|50753611|ref|XP_414065.1| PREDICTED: similar to guanine nucle... 65 2e-09
gi|49076166|ref|XP_402089.1| GBA3_USTMA Guanine nucleotide-bindi... 65 2e-09
gi|631009|pir||S40508 GTP-binding regulatory protein Gi3 alpha c... 65 2e-09
gi|41055760|ref|NP_957265.1| similar to guanine nucleotide bindi... 65 2e-09
gi|25742654|ref|NP_445994.1| guanine nucleotide binding protein,... 65 3e-09
gi|3289977|gb|AAC25612.1| GNA15; ALPHA-16 [Homo sapiens] 65 3e-09
gi|25295771|pir||JC7661 G protein alpha subunit Rga2 protein - R... 65 3e-09
gi|1000030|pdb|1GIL| G I Alpha1 (Guanine Nucleotide-Binding Pro... 65 3e-09
gi|18858765|ref|NP_571944.1| guanine nucleotide binding protein ... 65 3e-09
gi|27805891|ref|NP_776751.1| guanine nucleotide binding protein ... 65 3e-09
gi|3913716|sp|O14438|GBA3_USTHO Guanine nucleotide-binding prote... 65 3e-09
gi|1346103|sp|P49082|GBA1_LOTJA Guanine nucleotide-binding prote... 65 4e-09
gi|46122315|ref|XP_385711.1| GBA1_CRYPA Guanine nucleotide-bindi... 65 4e-09
gi|38101799|gb|EAA48707.1| GBA1_MAGGR Guanine nucleotide-binding... 65 4e-09
gi|478708|pir||S27015 GTP-binding regulatory protein Gs alpha ch... 65 4e-09
gi|31197857|ref|XP_307876.1| ENSANGP00000004036 [Anopheles gambi... 64 6e-09
gi|7441574|pir||T37245 GTP-binding regulatory protein Gs alpha-S... 64 6e-09
gi|5139713|dbj|BAA81700.1| G protein a subunit 4 [Ephydatia fluv... 64 6e-09
gi|2851469|sp|P38406|GBAF_RAT Guanine nucleotide-binding protein... 64 6e-09
gi|4504043|ref|NP_002062.1| guanine nucleotide binding protein (... 64 6e-09
gi|47271350|ref|NP_034437.1| guanine nucleotide binding protein,... 64 6e-09
gi|21749110|dbj|BAC03535.1| unnamed protein product [Homo sapiens] 64 6e-09
gi|25141265|ref|NP_490817.2| guanine nucleotide-binding protein ... 64 6e-09
gi|37524027|gb|AAQ92314.1| G-protein a-subunit s class [Pinctada... 64 6e-09
gi|5139701|dbj|BAA81694.1| G protein a subunit 2 [Hydra magnipap... 64 6e-09
gi|33695153|ref|NP_892023.1| guanine nucleotide binding protein ... 64 6e-09
gi|46136197|ref|XP_389790.1| GBA3_NEUCR Guanine nucleotide-bindi... 64 6e-09
gi|3047015|gb|AAC13568.1| GTP binding protein Gz subunit alpha [... 64 6e-09
gi|17534673|ref|NP_494748.1| G Protein, Alpha subunit (42.2 kD) ... 64 7e-09
gi|6016104|sp|O74227|GBA1_COCHE Guanine nucleotide-binding prote... 64 7e-09
gi|3929351|sp|O13315|GBA1_MAGGR Guanine nucleotide-binding prote... 64 7e-09
gi|232141|sp|P30684|GBAS_LYMST Guanine nucleotide-binding protei... 64 7e-09
gi|39580191|emb|CAE71597.1| Hypothetical protein CBG18556 [Caeno... 64 7e-09
gi|7496077|pir||T33351 hypothetical protein C16A11.1 - Caenorhab... 64 7e-09
gi|21636308|gb|AAM69919.1| G protein alpha subunit Tga3 [Trichod... 64 7e-09
gi|17510719|ref|NP_490790.1| SPiNdle orientation defective SPN-1... 64 7e-09
gi|14133507|gb|AAK54043.1| G protein alpha subunit 3 [Strongyloi... 64 7e-09
gi|17481199|dbj|BAB79197.1| G protein alpha subunit i class [Hal... 64 7e-09
gi|30024658|gb|AAP13579.1| guanine nucleotide binding protein al... 64 7e-09
gi|34190601|gb|AAH30027.2| GNAO1 protein [Homo sapiens] 64 9e-09
gi|17507901|ref|NP_491715.1| G Protein, Alpha subunit (42.0 kD) ... 64 9e-09
gi|41148050|ref|XP_374627.1| similar to Guanine nucleotide-bindi... 64 9e-09
gi|31197465|ref|XP_307680.1| ENSANGP00000002249 [Anopheles gambi... 64 9e-09
gi|204444|gb|AAA41262.1| Guanine nucleotide-binding protein alph... 64 9e-09
gi|7416007|dbj|BAA93639.1| G protein a subunit s class [Octopus ... 64 9e-09
gi|47825404|ref|NP_001001476.1| guanine nucleotide-binding prote... 64 9e-09
gi|2293546|gb|AAB65427.1| MAGC [Magnaporthe grisea] 64 9e-09
gi|3789980|gb|AAC67569.1| cone transducin alpha subunit [Ambysto... 64 9e-09
gi|45382711|ref|NP_990021.1| cone-type transducin alpha subunit ... 64 9e-09
gi|20259689|gb|AAM14395.1| G-protein alpha subunit CPG-3 [Crypho... 64 9e-09
gi|45383628|ref|NP_989580.1| guanine nucleotide binding protein ... 64 9e-09
gi|232150|sp|P30682|GBI_LYMST Guanine nucleotide-binding protein... 64 9e-09
gi|3929354|sp|O42784|GBA1_COLTR Guanine nucleotide-binding prote... 63 1e-08
gi|49085312|ref|XP_404788.1| GBA1_EMENI Guanine nucleotide-bindi... 63 1e-08
gi|31746691|gb|AAP68962.1| G protein, alpha subunit protein 14, ... 63 1e-08
gi|47550899|ref|NP_999968.1| GNAS complex locus [Danio rerio] >g... 63 1e-08
gi|25295769|pir||D87723 protein R06A10.2 [imported] - Caenorhabd... 63 2e-08
gi|32411735|ref|XP_326348.1| GUANINE NUCLEOTIDE-BINDING PROTEIN ... 63 2e-08
gi|17561834|ref|NP_506160.1| G Protein, Alpha subunit (42.4 kD) ... 63 2e-08
gi|4101576|gb|AAD01207.1| G protein alpha subunit [Neurospora cr... 63 2e-08
gi|585175|sp|Q05424|GBA2_NEUCR Guanine nucleotide-binding protei... 63 2e-08
gi|31213965|ref|XP_315788.1| ENSANGP00000004423 [Anopheles gambi... 63 2e-08
gi|3913724|sp|P93163|GBA2_SOYBN Guanine nucleotide-binding prote... 62 2e-08
gi|7416005|dbj|BAA93638.1| G protein a subunit q class [Octopus ... 62 2e-08
gi|27728513|gb|AAO18659.1| G protein alpha subunit [Hypocrea vir... 62 2e-08
gi|163130|gb|AAA30561.1| p-alpha-h subunit 62 2e-08
gi|50728081|ref|XP_425425.1| PREDICTED: similar to Guanine nucle... 62 2e-08
gi|1730230|sp|P51876|GBI_HELTI Guanine nucleotide-binding protei... 62 2e-08
gi|47230366|emb|CAF99559.1| unnamed protein product [Tetraodon n... 62 2e-08
gi|1730208|sp|P52206|GB11_CANFA Guanine nucleotide-binding prote... 62 3e-08
gi|19114715|ref|NP_593803.1| guanine nucleotide-binding protein ... 62 3e-08
gi|539073|pir||A46393 GTP-binding protein alpha chain gpa2 - fis... 62 3e-08
gi|260894|gb|AAB24332.1| signal-transducing G protein alpha q su... 62 3e-08
gi|30315890|sp|Q9XZV3|GB0_GEOCY Guanine nucleotide-binding prote... 62 4e-08
gi|17507903|ref|NP_492312.1| G Protein, Alpha subunit (40.9 kD) ... 62 4e-08
gi|25295770|pir||JC7660 G protein alpha subunit, Rga1 protein - ... 62 4e-08
gi|17561838|ref|NP_504745.1| G Protein, Alpha subunit (41.6 kD) ... 62 4e-08
gi|7441569|pir||T09152 GTP-binding regulatory protein alpha chai... 62 4e-08
gi|50260864|gb|EAL23514.1| hypothetical protein CNBA1610 [Crypto... 62 4e-08
gi|1346104|sp|P49083|GBA1_ORYSA Guanine nucleotide-binding prote... 62 4e-08
gi|49256367|gb|AAH74466.1| Unknown (protein for IMAGE:6950346) [... 61 5e-08
gi|20270698|gb|AAM18375.1| G-protein alpha subunit [Leptosphaeri... 61 5e-08
gi|15072479|gb|AAK74191.1| protein GTPase Tga1 [Trichoderma atro... 61 5e-08
gi|13539547|emb|CAC35694.1| G protein alpha subunit [Oculimacula... 61 5e-08
gi|2130075|pir||S56670 GTP-binding regulatory protein alpha chai... 61 6e-08
gi|862310|gb|AAC41657.1| G protein alpha-subunit 61 6e-08
gi|21591543|gb|AAM64110.1| G-alpha subunit [Penicillium marneffei] 61 6e-08
gi|25144868|ref|NP_499921.2| G Protein, Alpha subunit (41.7 kD) ... 60 8e-08
gi|38112307|gb|AAR11243.1| guanine nucleotide-binding protein [P... 60 8e-08
gi|11245655|gb|AAF71788.2| G protein alpha subunit [Hordeum vulg... 60 8e-08
gi|50757869|ref|XP_415686.1| PREDICTED: similar to guanine nucle... 60 8e-08
gi|38112309|gb|AAR11244.1| guanine nucleotide-binding protein [M... 60 8e-08
gi|1698500|gb|AAB37244.1| G protein alpha subunit 60 8e-08
gi|19068016|gb|AAL11436.1| G-protein alpha subunit 1 [Phytophtho... 60 1e-07
gi|16215392|emb|CAC82735.1| G-protein alpha subunit [Xenopus lae... 60 1e-07
gi|10312058|emb|CAC10177.1| G protein alpha subunit [Blumeria gr... 60 1e-07
gi|49522173|gb|AAH75226.1| Unknown (protein for MGC:84412) [Xeno... 60 1e-07
gi|1345101|gb|AAC49296.1| guanine nucleotide binding protein 60 1e-07
gi|39595387|emb|CAE60425.1| Hypothetical protein CBG04031 [Caeno... 60 1e-07
gi|3913709|sp|O04279|GBA2_PEA Guanine nucleotide-binding protein... 60 1e-07
gi|6754006|ref|NP_034432.1| guanine nucleotide binding protein, ... 60 1e-07
gi|49904442|gb|AAH76540.1| Zgc:92392 protein [Danio rerio] 60 1e-07
gi|40037204|gb|AAR37394.1| G-protein alpha subunit [Sporothrix s... 60 1e-07
gi|120999|sp|P25157|GBAL_DROME Guanine nucleotide-binding protei... 60 1e-07
gi|120989|sp|P26981|GBA1_LYCES Guanine nucleotide-binding protei... 60 1e-07
gi|22476942|gb|AAM97352.1| G protein alpha II subunit [Pisum sat... 60 1e-07
gi|18606326|gb|AAL57853.2| G protein alpha subunit [Sporothrix s... 59 2e-07
gi|3913717|sp|O16118|GBAS_HOMAM Guanine nucleotide-binding prote... 59 2e-07
gi|48095594|ref|XP_394484.1| similar to ENSANGP00000009208 [Apis... 59 2e-07
gi|50287657|ref|XP_446258.1| unnamed protein product [Candida gl... 59 2e-07
gi|27465189|gb|AAN65182.1| G protein alpha subunit [Hypocrea vir... 59 2e-07
gi|37595921|gb|AAQ94737.1| G-alpha subunit [Phaeosphaeria nodorum] 59 2e-07
gi|42725783|gb|AAS38579.1| guanine nucleotide-binding protein G(... 59 2e-07
gi|27524346|emb|CAC81704.1| guanine nucleotide binding protein a... 59 2e-07
gi|5139715|dbj|BAA81701.1| G protein a subunit 5 [Ephydatia fluv... 59 2e-07
gi|5139705|dbj|BAA81696.1| G protein a subunit 4 [Hydra magnipap... 59 2e-07
gi|13591953|ref|NP_112296.1| guanine nucleotide binding protein ... 59 2e-07
gi|30923558|gb|EAA46036.1| CG17678-PA.3 [Drosophila melanogaster] 59 2e-07
gi|5566081|gb|AAD45318.1| heterotrimeric G protein alpha subunit... 59 2e-07
gi|3334195|sp|Q40224|GBA1_LUPLU Guanine nucleotide-binding prote... 59 2e-07
gi|3913725|sp|P93564|GBA1_SOLTU Guanine nucleotide-binding prote... 59 2e-07
gi|3913708|sp|O04278|GBA1_PEA Guanine nucleotide-binding protein... 59 2e-07
gi|17137790|ref|NP_477502.1| CG10060-PA [Drosophila melanogaster... 59 3e-07
gi|71901|pir||RGFFA GTP-binding regulatory protein Gi alpha chai... 59 3e-07
gi|22336036|dbj|BAC10502.1| G protein alpha subunit [Triticum ae... 59 3e-07
gi|28829380|gb|AAO51920.1| similar to Dictyostelium discoideum (... 59 3e-07
gi|7507346|pir||T32578 hypothetical protein T07A9.7 - Caenorhabd... 59 3e-07
gi|17137798|ref|NP_477506.1| CG2835-PA [Drosophila melanogaster]... 59 3e-07
gi|38103784|gb|EAA50445.1| hypothetical protein MG04204.4 [Magna... 59 3e-07
gi|34147944|gb|AAQ62550.1| G-protein alpha subunit Cga2 [Cryptoc... 59 3e-07
gi|7330345|gb|AAB24072.2| G-protein alpha i subunit [Homarus ame... 59 3e-07
gi|50758931|ref|XP_417485.1| PREDICTED: similar to MGC68706 prot... 58 4e-07
gi|39595606|emb|CAE67107.1| Hypothetical protein CBG12520 [Caeno... 58 4e-07
gi|32140279|gb|AAO41857.1| G protein alpha subunit [Penicillium ... 58 5e-07
gi|18032048|gb|AAL51157.1| G protein alpha subunit 3 [Solanum tu... 58 5e-07
gi|42476111|ref|NP_031379.2| guanine nucleotide binding protein ... 58 5e-07
gi|20147695|gb|AAM12615.1| guanine nucleotide binding protein al... 58 5e-07
gi|182994|gb|AAA35867.1| Ga subunit 58 5e-07
gi|49071686|ref|XP_400132.1| GBA2_USTMA Guanine nucleotide-bindi... 58 5e-07
gi|1169856|sp|P34045|GBA7_DICDI Guanine nucleotide-binding prote... 58 5e-07
gi|47220675|emb|CAG06597.1| unnamed protein product [Tetraodon n... 58 5e-07
gi|462162|sp|P34042|GBA4_DICDI Guanine nucleotide-binding protei... 58 5e-07
gi|31209981|ref|XP_313957.1| ENSANGP00000010002 [Anopheles gambi... 57 7e-07
gi|18654413|gb|AAL77628.1| G protein alpha subunit [Takifugu rub... 57 9e-07
gi|39579531|emb|CAE56865.1| Hypothetical protein CBG24698 [Caeno... 57 9e-07
gi|18369796|dbj|BAB84093.1| heterotrimeric GTP binding protein a... 57 9e-07
gi|10048263|gb|AAG12329.1| heterotrimeric GTP-binding protein su... 57 1e-06
gi|19112752|ref|NP_595960.1| guanine nucleotide-binding protein ... 56 2e-06
gi|39582795|emb|CAE74258.1| Hypothetical protein CBG21947 [Caeno... 56 2e-06
gi|22336032|dbj|BAC10501.1| G protein alpha subunit [Triticum ae... 56 2e-06
gi|17481219|dbj|BAB79202.1| G protein alpha subunit s class [Hal... 56 2e-06
gi|173560|gb|AAA18403.1| putative. G-alpha-like protein 56 2e-06
gi|17137796|ref|NP_477505.1| CG2835-PB [Drosophila melanogaster]... 56 2e-06
gi|2144866|pir||RGHUA2 GTP-binding regulatory protein Gs alpha c... 56 2e-06
gi|49091532|ref|XP_407227.1| conserved hypothetical protein [Asp... 56 2e-06
gi|22476944|gb|AAM97353.1| G protein alpha II subunit [Pisum sat... 56 2e-06
gi|6137656|pdb|1CJK|C Chain C, Complex Of Gs-Alpha With The Cata... 55 3e-06
gi|6321792|ref|NP_011868.1| Involved in the mating pheromone sig... 55 3e-06
gi|46136945|ref|XP_390164.1| hypothetical protein FG09988.1 [Gib... 55 3e-06
gi|18032046|gb|AAL51156.1| heterotrimeric G protein alpha subuni... 55 3e-06
gi|22770980|gb|AAN06816.1| G protein alpha I subunit [Pisum sati... 55 3e-06
gi|101032|pir||A41106 GTP-binding protein alpha chain gpa1 - fis... 55 3e-06
gi|121000|sp|P04896|GBAS_BOVIN Guanine nucleotide-binding protei... 55 3e-06
gi|31952|emb|CAA30084.1| unnamed protein product [Homo sapiens] 55 3e-06
gi|949880|emb|CAA87631.1| G protein alpha-a subunit [Lymnaea sta... 55 3e-06
gi|13539549|emb|CAC35695.1| G protein alpha subunit [Oculimacula... 55 3e-06
gi|5139723|dbj|BAA81705.1| G protein a subunit 9 [Ephydatia fluv... 55 4e-06
gi|9506737|ref|NP_062005.1| GNAS complex locus; Guanine nucleoti... 55 4e-06
gi|71881|pir||RGMSA2 GTP-binding regulatory protein Gs alpha-S2 ... 55 4e-06
gi|121001|sp|P16052|GBAS_CRILO Guanine nucleotide-binding protei... 55 4e-06
gi|4504047|ref|NP_000507.1| guanine nucleotide binding protein (... 55 4e-06
gi|34536212|dbj|BAC87579.1| unnamed protein product [Homo sapiens] 55 4e-06
gi|5139717|dbj|BAA81702.1| G protein a subunit 6 [Ephydatia fluv... 55 4e-06
gi|30585277|gb|AAP36911.1| Homo sapiens GNAS complex locus [synt... 55 4e-06
gi|5139707|dbj|BAA81697.1| G protein a subunit 1 [Ephydatia fluv... 55 4e-06
gi|40882505|gb|AAR96164.1| RE53936p [Drosophila melanogaster] 54 6e-06
gi|50543488|ref|XP_499910.1| hypothetical protein [Yarrowia lipo... 54 6e-06
gi|19702467|gb|AAL93256.1| guanine nucleotide-binding protein G(... 54 6e-06
gi|17568407|ref|NP_510189.1| G Protein, Alpha subunit (42.1 kD) ... 54 6e-06
gi|47228774|emb|CAG07506.1| unnamed protein product [Tetraodon n... 54 6e-06
gi|5139709|dbj|BAA81698.1| G protein a subunit 2 [Ephydatia fluv... 54 6e-06
gi|7505996|pir||T23705 hypothetical protein M04C7.1 - Caenorhabd... 54 7e-06
gi|19068018|gb|AAL11437.1| G-protein alpha subunit 1 [Phytophtho... 54 7e-06
gi|2982077|pdb|1AZS|C Chain C, Complex Of Gs-Alpha With The Cata... 54 7e-06
gi|47218963|emb|CAF98161.1| unnamed protein product [Tetraodon n... 54 7e-06
gi|40254582|ref|NP_034433.2| guanine nucleotide binding protein,... 54 7e-06
gi|120984|sp|P27601|GB13_MOUSE Guanine nucleotide-binding protei... 54 7e-06
gi|106197|pir||B39394 GTP-binding regulatory protein Gy2 alpha -... 54 7e-06
gi|4973028|gb|AAD34893.1| G protein alpha subunit homolog GanAp ... 54 7e-06
gi|18426900|ref|NP_536351.1| guanine nucleotide binding protein ... 54 7e-06
gi|13096682|pdb|1CUL|C Chain C, Complex Of Gs-Alpha With The Cat... 54 7e-06
gi|38181790|gb|AAH61496.1| Gnas protein [Mus musculus] 54 7e-06
gi|50736513|ref|XP_419116.1| PREDICTED: similar to Guanine nucle... 54 1e-05
gi|46443501|gb|EAL02782.1| hypothetical protein CaO19.9189 [Cand... 54 1e-05
gi|386748|gb|AAA52583.1| guanine nucleotide-binding protein alph... 54 1e-05
gi|39932590|sp|Q86D96|GBA1_TRIVA Guanine nucleotide-binding prot... 53 1e-05
gi|7498003|pir||T29826 hypothetical protein C55H1.2 - Caenorhabd... 53 1e-05
gi|34875240|ref|XP_221066.2| similar to GTP-binding regulatory p... 53 1e-05
gi|30314178|gb|AAP12457.1| G protein alpha subunit; GPA3 [Mucor ... 53 1e-05
gi|47271396|ref|NP_034439.2| guanine nucleotide binding protein ... 53 1e-05
gi|24111250|ref|NP_006563.2| guanine nucleotide binding protein ... 53 1e-05
gi|45439860|gb|AAS64389.1| Galpha13 [Rattus norvegicus] >gnl|BL_... 53 1e-05
gi|2135318|pir||I57490 guanine nucleotide regulatory protein - h... 53 1e-05
gi|39583178|emb|CAE61396.1| Hypothetical protein CBG05252 [Caeno... 53 1e-05
gi|562018|gb|AAA82037.1| Gi-alpha-2 protein 53 1e-05
gi|18426898|ref|NP_536350.1| guanine nucleotide binding protein ... 53 1e-05
gi|12057026|emb|CAC19872.1| G protein alpha subunit [Botryotinia... 53 2e-05
gi|1353512|gb|AAB01735.1| G protein alpha t1 (rod transducin) 53 2e-05
gi|39597658|emb|CAE68349.1| Hypothetical protein CBG14082 [Caeno... 53 2e-05
gi|1730211|sp|P34043|GBA5_DICDI Guanine nucleotide-binding prote... 53 2e-05
gi|47498042|ref|NP_998855.1| hypothetical protein MGC69295 [Xeno... 52 2e-05
gi|49086174|ref|XP_405153.1| hypothetical protein AN1016.2 [Aspe... 52 2e-05
gi|4262551|gb|AAD14686.1| G-protein XLalphas [Mus musculus] 52 2e-05
gi|49078510|ref|XP_403000.1| GBA4_USTMA Guanine nucleotide-bindi... 52 2e-05
gi|386745|gb|AAA53148.1| guanine nucleotide-binding protein G-s-... 52 3e-05
gi|45219789|gb|AAH66923.1| Guanine nucleotide binding protein (G... 52 3e-05
gi|13936842|gb|AAK49966.1| inhibitory GTP-binding protein subuni... 52 3e-05
gi|14161099|emb|CAC39211.1| XLalphas protein [Rattus norvegicus] 52 3e-05
gi|157537|gb|AAA28583.1| G protein alpha subunit [Drosophila mel... 52 3e-05
gi|739577|prf||2003375B guanine nucleotide-binding protein Gs al... 52 3e-05
gi|18369802|dbj|BAB84096.1| heterotrimeric GTP binding protein a... 52 3e-05
gi|18369798|dbj|BAB84094.1| heterotrimeric GTP binding protein a... 52 3e-05
gi|19577354|emb|CAD28435.1| probable g protein alpha subunit [As... 52 3e-05
gi|1346105|sp|P49084|GBA1_SOYBN Guanine nucleotide-binding prote... 52 3e-05
gi|183689|gb|AAA52619.1| guanine nucleotide-binding regulatory p... 52 3e-05
gi|1086315|pir||S52418 GTP-binding regulatory protein Gs alpha-X... 52 3e-05
gi|121004|sp|P24799|GBAS_XENLA Guanine nucleotide-binding protei... 52 4e-05
gi|3047017|gb|AAC13569.1| GTP binding protein Gz subunit alpha [... 52 4e-05
gi|6754016|ref|NP_034440.1| guanine nucleotide binding protein a... 52 4e-05
gi|4206776|gb|AAD11802.1| guanine nucleotide-binding protein [Ra... 52 4e-05
gi|39596217|emb|CAE69854.1| Hypothetical protein CBG16182 [Caeno... 51 5e-05
gi|17568409|ref|NP_509557.1| G Protein, Alpha subunit (42.0 kD) ... 51 5e-05
gi|25295773|pir||D89605 protein F18G5.3 [imported] - Caenorhabdi... 51 5e-05
gi|5139719|dbj|BAA81703.1| G protein a subunit 7 [Ephydatia fluv... 51 5e-05
gi|50552836|ref|XP_503828.1| hypothetical protein [Yarrowia lipo... 51 5e-05
>gi|17556474|ref|NP_497585.1| guanine nucleotide binding protein alpha
11 like, possibly N-myristoylated (47.2 kD) (3D677)
[Caenorhabditis elegans]
gi|7105641|gb|AAF36036.1| Hypothetical protein Y71H2B.7
[Caenorhabditis elegans]
Length = 406
Score = 815 bits (2105), Expect = 0.0
Identities = 406/406 (100%), Positives = 406/406 (100%)
Frame = +1
Query: 1 MGSLCSREEDGNDTVTTMNGQNKKKTKKEGDIIHFFMLGIEGAGKTTIVRQLKCLCIQKP 180
MGSLCSREEDGNDTVTTMNGQNKKKTKKEGDIIHFFMLGIEGAGKTTIVRQLKCLCIQKP
Sbjct: 1 MGSLCSREEDGNDTVTTMNGQNKKKTKKEGDIIHFFMLGIEGAGKTTIVRQLKCLCIQKP 60
Query: 181 QSYQMYDDSWNLIDREKIFDNYELENLKNVVRINLLTAANSLIRKVRETDEEHMRSSGAA 360
QSYQMYDDSWNLIDREKIFDNYELENLKNVVRINLLTAANSLIRKVRETDEEHMRSSGAA
Sbjct: 61 QSYQMYDDSWNLIDREKIFDNYELENLKNVVRINLLTAANSLIRKVRETDEEHMRSSGAA 120
Query: 361 AAVLRRCSQLYEAEVDIYDISNQIEDEYGAYIIEILSDPQIRRCLDQGPPVKIEDGTRFF 540
AAVLRRCSQLYEAEVDIYDISNQIEDEYGAYIIEILSDPQIRRCLDQGPPVKIEDGTRFF
Sbjct: 121 AAVLRRCSQLYEAEVDIYDISNQIEDEYGAYIIEILSDPQIRRCLDQGPPVKIEDGTRFF 180
Query: 541 LKDEGRIRNIFTHSYQLTNDDIVHVRKPTVSFKSYKFRIKQLRVEIHDMGGQKSELVKIP 720
LKDEGRIRNIFTHSYQLTNDDIVHVRKPTVSFKSYKFRIKQLRVEIHDMGGQKSELVKIP
Sbjct: 181 LKDEGRIRNIFTHSYQLTNDDIVHVRKPTVSFKSYKFRIKQLRVEIHDMGGQKSELVKIP 240
Query: 721 QFMRQFLTTDGHCFLLYVSSLAAFQEPDKDVKGRTVLDKSAAIFKLVLEMNGVDECTVMI 900
QFMRQFLTTDGHCFLLYVSSLAAFQEPDKDVKGRTVLDKSAAIFKLVLEMNGVDECTVMI
Sbjct: 241 QFMRQFLTTDGHCFLLYVSSLAAFQEPDKDVKGRTVLDKSAAIFKLVLEMNGVDECTVMI 300
Query: 901 FFNKQDRFEEICREMMQKEDGKRQLEKVLGIPPKVQKEGKKGKPENYDHLKDAIRSRFKE 1080
FFNKQDRFEEICREMMQKEDGKRQLEKVLGIPPKVQKEGKKGKPENYDHLKDAIRSRFKE
Sbjct: 301 FFNKQDRFEEICREMMQKEDGKRQLEKVLGIPPKVQKEGKKGKPENYDHLKDAIRSRFKE 360
Query: 1081 ILKENNDKKSYYMKYTQATDAQLMSTIFYAVENEIISSYFTQARYI 1218
ILKENNDKKSYYMKYTQATDAQLMSTIFYAVENEIISSYFTQARYI
Sbjct: 361 ILKENNDKKSYYMKYTQATDAQLMSTIFYAVENEIISSYFTQARYI 406
>gi|39590618|emb|CAE64988.1| Hypothetical protein CBG09823
[Caenorhabditis briggsae]
Length = 415
Score = 694 bits (1792), Expect = 0.0
Identities = 350/415 (84%), Positives = 376/415 (90%), Gaps = 9/415 (2%)
Frame = +1
Query: 1 MGSLCSREEDGNDTVTTMNGQNKKKTKKEGDIIHFFMLGIEGAGKTTIVRQLKCLCIQKP 180
MGSLCSREEDG D +TTMNG K KTKKE DIIHFFMLGIEGAGKTTI+RQLKCLC+QKP
Sbjct: 1 MGSLCSREEDGEDAMTTMNGTGKSKTKKESDIIHFFMLGIEGAGKTTIIRQLKCLCMQKP 60
Query: 181 QSYQMYDDSWNLIDREKIFDNYELENLKNVVRINLLTAANSLIRKVRETDEEHMRSSGAA 360
+YQMYDDSWNLIDREKIFD YELE LKNVVRINLLTAA SLIRK R+ DEE +RSS AA
Sbjct: 61 HNYQMYDDSWNLIDREKIFDYYELEGLKNVVRINLLTAAASLIRKARDRDEEFLRSSTAA 120
Query: 361 AAVLRRCSQLYEAEVDIYDISNQIEDEYGAYIIEILSDPQIRRCLDQGPPV---KIEDGT 531
AA+LR+CSQLYE EVDIYD SNQIEDEYG +IIEI+SDPQ+ R L+Q V KIEDGT
Sbjct: 121 AAILRKCSQLYEGEVDIYDHSNQIEDEYGGFIIEIISDPQVVRLLEQPIGVAGLKIEDGT 180
Query: 532 RFFLKDEGRIRNIFTHSYQLTNDDIVHVRKPTVSFKSYKFRIKQLRVEIHDMGGQKSELV 711
R+FLKDEGRIRNIFT SYQLTNDDIVHVRKPTVSFKSYKFRIKQLRVEIHDMGGQKSELV
Sbjct: 181 RYFLKDEGRIRNIFTDSYQLTNDDIVHVRKPTVSFKSYKFRIKQLRVEIHDMGGQKSELV 240
Query: 712 KIPQFMRQFLTTDGHCFLLYVSSLAAFQEPDKDVKGRTVLDKSAAIFKLVLEMNGVDECT 891
KIPQFMRQFLTT GHCFLLYVSSLAAFQEPDKD KGRTVLDKSAAIFKLVLEM+GVDECT
Sbjct: 241 KIPQFMRQFLTTSGHCFLLYVSSLAAFQEPDKDSKGRTVLDKSAAIFKLVLEMSGVDECT 300
Query: 892 VMIFFNKQDRFEEICREMMQKED--GKRQLEKVLGIPPKVQKE----GKKGKPENYDHLK 1053
VMIFFNKQDRFEEICREM+Q +D GKRQ+EK+LG+PPK+ K GKK KPENYD+LK
Sbjct: 301 VMIFFNKQDRFEEICREMLQNDDGEGKRQIEKLLGVPPKLPKNQKEGGKKNKPENYDYLK 360
Query: 1054 DAIRSRFKEILKENNDKKSYYMKYTQATDAQLMSTIFYAVENEIISSYFTQARYI 1218
D+IR+RFKEILK NNDKKSYYMKYTQATDAQLMSTIFYAVENEIIS++FTQARY+
Sbjct: 361 DSIRNRFKEILKNNNDKKSYYMKYTQATDAQLMSTIFYAVENEIISAFFTQARYL 415