Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y73B6BL_11
         (399 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17544144|ref|NP_500967.1| phytoene dehydrogenase-like (15.0 k...   223   9e-58
gi|39584184|emb|CAE61559.1| Hypothetical protein CBG05468 [Caeno...   209   1e-53
gi|31212763|ref|XP_315366.1| ENSANGP00000021123 [Anopheles gambi...    82   2e-15
gi|47219292|emb|CAG10921.1| unnamed protein product [Tetraodon n...    82   3e-15
gi|34863091|ref|XP_215245.2| similar to hypothetical protein MGC...    82   3e-15
gi|46852398|ref|NP_776170.2| biogenesis of lysosome-related orga...    81   4e-15
gi|25055365|ref|XP_193940.1| RIKEN cDNA 2410089B13 [Mus musculus...    81   4e-15
gi|50749448|ref|XP_421639.1| PREDICTED: similar to biogenesis of...    81   5e-15
gi|48101331|ref|XP_395102.1| similar to ENSANGP00000016575 [Apis...    79   2e-14
gi|47717129|ref|NP_001001342.1| biogenesis of lysosome-related o...    78   3e-14
gi|41351235|gb|AAH65806.1| Unknown (protein for MGC:73814) [Mus ...    78   5e-14
gi|24662431|ref|NP_648427.1| CG14145-PA [Drosophila melanogaster...    74   7e-13
gi|38073360|ref|XP_136222.3| similar to hypothetical protein MGC...    71   6e-12
gi|46390968|dbj|BAD16481.1| phytoene dehydrogenase-like protein ...    57   8e-08
gi|18423040|ref|NP_568711.1| expressed protein [Arabidopsis thal...    52   4e-06
gi|21592679|gb|AAM64628.1| unknown [Arabidopsis thaliana]              51   5e-06
gi|10177621|dbj|BAB10768.1| phytoene dehydrogenase-like [Arabido...    45   3e-04
gi|3360502|gb|AAC62621.1| heat shock protein [Plectonema boryanum]     40   0.008
gi|46228860|gb|EAK89730.1| uncharacterized protein with several ...    40   0.014
gi|16800754|ref|NP_471022.1| similar to ATP-dependent dsDNA exon...    38   0.052
gi|30261197|ref|NP_843574.1| conserved hypothetical protein [Bac...    37   0.089
gi|29570447|gb|AAN73857.2| Hypothetical protein M4.1 [Caenorhabd...    36   0.15
gi|7506100|pir||T33753 hypothetical protein M4.1 - Caenorhabditi...    36   0.15
gi|21399007|ref|NP_654992.1| ABC2_membrane, ABC-2 type transport...    36   0.20
gi|23128981|ref|ZP_00110817.1| COG2319: FOG: WD40 repeat [Nostoc...    35   0.26
gi|111999|pir||S21801 myosin heavy chain, neuronal [similarity] ...    35   0.34
gi|31979127|gb|AAP68707.1| SabA [Helicobacter pylori]                  35   0.34
gi|31979134|gb|AAP68709.1| SabA [Helicobacter pylori]                  35   0.34
gi|31979129|gb|AAP68708.1| SabA [Helicobacter pylori]                  35   0.34
gi|31979138|gb|AAP68711.1| SabA [Helicobacter pylori]                  35   0.34
gi|25404087|pir||F96601 hypothetical protein T6h22.16 [imported]...    35   0.44
gi|2326352|emb|CAA72043.1| hypothetical protein [Arabidopsis tha...    35   0.44
gi|7485153|pir||F71424 hypothetical protein - Arabidopsis thalia...    35   0.44
gi|15611729|ref|NP_223380.1| putative Outer membrane protein [He...    35   0.44
gi|15222827|ref|NP_176000.1| U-box domain-containing protein [Ar...    35   0.44
gi|15646201|ref|NP_207519.1| outer membrane protein [Helicobacte...    35   0.44
gi|48098259|ref|XP_397502.1| hypothetical protein XP_397502 [Api...    35   0.44
gi|15234750|ref|NP_193324.1| expressed protein [Arabidopsis thal...    35   0.44
gi|6679062|ref|NP_032723.1| ninein [Mus musculus] >gnl|BL_ORD_ID...    35   0.44
gi|49522624|gb|AAH75581.1| Unknown (protein for MGC:89563) [Xeno...    35   0.44
gi|15219846|ref|NP_176296.1| Nuf2 family protein [Arabidopsis th...    35   0.44
gi|45513460|ref|ZP_00165026.1| COG0419: ATPase involved in DNA r...    34   0.58
gi|30061483|ref|NP_817091.1| huntingtin-associated protein 1 iso...    34   0.58
gi|13162306|ref|NP_077047.1| huntingtin-associated protein 1 iso...    34   0.58
gi|50751217|ref|XP_422300.1| PREDICTED: similar to Tpr [Gallus g...    34   0.76
gi|31979123|gb|AAP68705.1| SabA [Helicobacter pylori]                  34   0.76
gi|50747172|ref|XP_420770.1| PREDICTED: similar to KIAA1276 prot...    34   0.76
gi|50287395|ref|XP_446127.1| unnamed protein product [Candida gl...    34   0.76
gi|19173130|ref|NP_596933.1| hypothetical protein [Encephalitozo...    34   0.76
gi|12060820|gb|AAG48252.1| serologically defined breast cancer a...    34   0.76
gi|38014688|gb|AAH60491.1| MGC68757 protein [Xenopus laevis]           33   0.99
gi|15606676|ref|NP_214056.1| putative protein [Aquifex aeolicus ...    33   0.99
gi|29245753|gb|EAA37375.1| GLP_559_5506_1160 [Giardia lamblia AT...    33   0.99
gi|47215764|emb|CAG02560.1| unnamed protein product [Tetraodon n...    33   0.99
gi|15644384|ref|NP_229436.1| conserved hypothetical protein [The...    33   0.99
gi|46433963|gb|EAK93387.1| hypothetical protein CaO19.7840 [Cand...    33   0.99
gi|29421246|gb|AAO59285.1| kinesin [Botryotinia fuckeliana]            33   0.99
gi|31979144|gb|AAP68712.1| SabA [Helicobacter pylori]                  33   0.99
gi|50755777|ref|XP_414897.1| PREDICTED: similar to LIS1-interact...    33   0.99
gi|47219799|emb|CAG03426.1| unnamed protein product [Tetraodon n...    33   0.99
gi|7076888|emb|CAB75938.1| intermediate filament protein C2 [Bra...    33   0.99
gi|28374984|emb|CAD66591.1| SMC protein [Acidithiobacillus ferro...    33   0.99
gi|15646200|ref|NP_207516.1| outer membrane protein [Helicobacte...    33   1.3
gi|34859534|ref|XP_347224.1| similar to A-kinase anchor protein ...    33   1.3
gi|3986194|dbj|BAA34954.1| myosin heavy chain [Dugesia japonica]       33   1.3
gi|50400728|sp|Q61043|NIN_MOUSE Ninein                                 33   1.3
gi|41614937|ref|NP_963435.1| NEQ140 [Nanoarchaeum equitans Kin4-...    33   1.3
gi|37360452|dbj|BAC98204.1| mKIAA1565 protein [Mus musculus]           33   1.3
gi|31199091|ref|XP_308493.1| ENSANGP00000022800 [Anopheles gambi...    33   1.3
gi|17505619|ref|NP_492501.1| protein kinase beta like (1J991) [C...    33   1.3
gi|42560833|ref|NP_975284.1| Prolipoprotein [Mycoplasma mycoides...    33   1.3
gi|31979136|gb|AAP68710.1| SabA [Helicobacter pylori]                  33   1.3
gi|34854301|ref|XP_342634.1| similar to A-kinase anchor protein ...    33   1.3
gi|31199093|ref|XP_308494.1| ENSANGP00000009515 [Anopheles gambi...    33   1.3
gi|17566982|ref|NP_504677.1| HoloCentric chromosome binding Prot...    33   1.7
gi|31979125|gb|AAP68706.1| SabA [Helicobacter pylori]                  33   1.7
gi|34869119|ref|XP_340983.1| similar to RIKEN cDNA C330027C09 [R...    33   1.7
gi|50424503|ref|XP_460839.1| unnamed protein product [Debaryomyc...    33   1.7
gi|23467090|ref|ZP_00122674.1| hypothetical protein [Haemophilus...    32   2.2
gi|117761|sp|P13627|CY1_PARDE Cytochrome c1 precursor >gnl|BL_OR...    32   2.2
gi|31239993|ref|XP_320410.1| ENSANGP00000016764 [Anopheles gambi...    32   2.2
gi|15611726|ref|NP_223377.1| putative Outer membrane protein [He...    32   2.2
gi|15899013|ref|NP_343618.1| BPS2 protein homolog (bps2) [Sulfol...    32   2.2
gi|37527769|ref|NP_931114.1| Nuclease sbcCD subunit C [Photorhab...    32   2.2
gi|17570263|ref|NP_509050.1| putative membrane protein, with 2 c...    32   2.2
gi|50084058|ref|YP_045568.1| putative chromosome segregation ATP...    32   2.2
gi|23307570|dbj|BAC16705.1| myosin heavy chain-like protein [Ory...    32   2.9
gi|6320004|ref|NP_010084.1| anti-silencing protein that causes d...    32   2.9
gi|1628363|emb|CAA67472.1| anti-silencing protein [Saccharomyces...    32   2.9
gi|15615219|ref|NP_243522.1| BH2656~unknown conserved protein in...    32   2.9
gi|50286207|ref|XP_445532.1| unnamed protein product [Candida gl...    32   3.8
gi|8392909|ref|NP_036869.1| apolipoprotein A-IV; Apolipoprotein ...    32   3.8
gi|50053824|ref|NP_001001932.1| early endosome antigen 1 [Mus mu...    32   3.8
gi|114008|sp|P02651|APA4_RAT Apolipoprotein A-IV precursor (Apo-...    32   3.8
gi|25149995|ref|NP_741903.1| intermediate Filament, A (66.5 kD) ...    32   3.8
gi|25149990|ref|NP_741902.1| intermediate Filament, A (66.5 kD) ...    32   3.8
gi|1850342|gb|AAB48030.1| Tpr [Homo sapiens]                           32   3.8
gi|39938603|ref|NP_950369.1| ATP-dependent Zn protease [Onion ye...    32   3.8
gi|29248415|gb|EAA39949.1| GLP_10_6401_9508 [Giardia lamblia ATC...    32   3.8
gi|4507659|ref|NP_003283.1| translocated promoter region (to act...    32   3.8
gi|26553608|ref|NP_757542.1| predicted cytoskeletal protein [Myc...    32   3.8
gi|34222535|sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 >gnl|B...    32   3.8
gi|7447203|pir||T18872 intermediate filament protein A - Caenorh...    32   3.8
gi|423123|pir||S33124 tpr protein - human                              32   3.8
gi|38090688|ref|XP_125851.4| similar to Early endosome antigen 1...    32   3.8
gi|18310751|ref|NP_562685.1| stage V sporulation protein D [Clos...    32   3.8
gi|13928452|dbj|BAB47119.1| 14-3-3 protein [Vigna angularis]           32   3.8
gi|48853154|ref|ZP_00307334.1| COG0443: Molecular chaperone [Fer...    32   3.8
gi|18379337|ref|NP_542131.1| suppressor of actin mutations 2-lik...    31   4.9
gi|26342158|dbj|BAC34741.1| unnamed protein product [Mus musculus]     31   4.9
gi|28499084|ref|XP_110209.3| SAC2 (supressor of actin mutations ...    31   4.9
gi|24653489|ref|NP_725336.1| CG18076-PB [Drosophila melanogaster...    31   4.9
gi|23124291|ref|ZP_00106289.1| COG1196: Chromosome segregation A...    31   4.9
gi|3372747|gb|AAC61313.1| repeat motif gene A protein [Borrelia ...    31   4.9
gi|7511874|pir||T13734 groovin gene protein - fruit fly (Drosoph...    31   4.9
gi|18379340|ref|NP_072047.3| suppressor of actin mutations 2-lik...    31   4.9
gi|24653487|ref|NP_725335.1| CG18076-PG [Drosophila melanogaster...    31   4.9
gi|6690788|gb|AAF24343.1| Short stop/Kakapo long isoform [Drosop...    31   4.9
gi|24653491|ref|NP_725337.1| CG18076-PE [Drosophila melanogaster...    31   4.9
gi|47208297|emb|CAF91435.1| unnamed protein product [Tetraodon n...    31   4.9
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap...    31   4.9
gi|6325437|ref|NP_015505.1| Subunit of a possibly tetrameric tri...    31   4.9
gi|29837770|gb|AAP05806.1| putative GAG-POL precursor [Oryza sat...    31   4.9
gi|15644689|ref|NP_206859.1| hypothetical protein HP0059 [Helico...    31   4.9
gi|24653497|ref|NP_725339.1| CG18076-PH [Drosophila melanogaster...    31   4.9
gi|24653495|ref|NP_725338.1| CG18076-PC [Drosophila melanogaster...    31   4.9
gi|14041697|emb|CAC38441.1| dJ1033B10.5.1 (SAC2 (suppressor of a...    31   4.9
gi|3811383|gb|AAC69899.1| Sacm21 [Mus musculus]                        31   4.9
gi|25411948|pir||B84583 hypothetical protein At2g19950 [imported...    31   4.9
gi|39599006|gb|AAR29046.1| gag-pol polyprotein [Aspergillus flavus]    31   4.9
gi|24653493|ref|NP_523733.2| CG18076-PA [Drosophila melanogaster...    31   4.9
gi|27777765|gb|AAL26311.2| polyprotein [Aspergillus flavus]            31   4.9
gi|20090845|ref|NP_616920.1| predicted protein [Methanosarcina a...    31   4.9
gi|30680839|ref|NP_179585.2| expressed protein [Arabidopsis thal...    31   4.9
gi|1848063|emb|CAA50182.1| Cytoplasmic intermediate filament (IF...    31   4.9
gi|4050106|gb|AAC97979.1| Sacm21 [Mus musculus]                        31   4.9
gi|17826763|emb|CAD18902.1| suppressor of action mutation 2-like...    31   4.9
gi|44917433|gb|AAS49041.1| At2g19950 [Arabidopsis thaliana]            31   4.9
gi|13376818|ref|NP_079490.1| CTCL tumor antigen se57-1 [Homo sap...    31   4.9
gi|6009571|dbj|BAA84968.1| NSP3 [Human rotavirus]                      31   6.4
gi|6754158|ref|NP_034534.1| huntingtin-associated protein 1 isof...    31   6.4
gi|21686711|ref|NP_663211.1| hypothetical protein [Phthorimaea o...    31   6.4
gi|15899022|ref|NP_343627.1| Purine NTPase [Sulfolobus solfatari...    31   6.4
gi|16331048|ref|NP_441776.1| ClpB protein [Synechocystis sp. PCC...    31   6.4
gi|15645080|ref|NP_207250.1| conserved hypothetical protein [Hel...    31   6.4
gi|23509283|ref|NP_701950.1| hypothetical protein [Plasmodium fa...    31   6.4
gi|17538296|ref|NP_502672.1| putative protein, with 2 coiled coi...    31   6.4
gi|50755359|ref|XP_414712.1| PREDICTED: similar to periplakin; 1...    31   6.4
gi|50287367|ref|XP_446113.1| unnamed protein product [Candida gl...    31   6.4
gi|17380463|sp|Q02819|NCB1_MOUSE Nucleobindin 1 precursor (CALNU...    31   6.4
gi|12841873|dbj|BAB25383.1| unnamed protein product [Mus musculus]     31   6.4
gi|34763238|ref|ZP_00144200.1| EXONUCLEASE SBCC [Fusobacterium n...    31   6.4
gi|19075736|ref|NP_588236.1| putative nuclear pore complex-assoc...    31   6.4
gi|26337061|dbj|BAC32214.1| unnamed protein product [Mus musculus]     31   6.4
gi|48851761|ref|ZP_00305959.1| COG1382: Prefoldin, chaperonin co...    31   6.4
gi|48851437|ref|ZP_00305661.1| COG2801: Transposase and inactiva...    31   6.4
gi|1083993|pir||S51727 NSP3 protein - human rotavirus (strain KU...    31   6.4
gi|50751160|ref|XP_422284.1| PREDICTED: similar to laminin, gamm...    31   6.4
gi|23480959|gb|EAA17380.1| clpB protein [Plasmodium yoelii yoelii]     31   6.4
gi|39595021|emb|CAE70889.1| Hypothetical protein CBG17679 [Caeno...    31   6.4
gi|48852614|ref|ZP_00306799.1| COG2801: Transposase and inactiva...    31   6.4
gi|48852693|ref|ZP_00306877.1| COG2801: Transposase and inactiva...    31   6.4
gi|30061481|ref|NP_817090.1| huntingtin-associated protein 1 iso...    31   6.4
gi|50309515|ref|XP_454767.1| ATP7_KLULA [Kluyveromyces lactis] >...    31   6.4
gi|3023324|sp|O13350|ATP7_KLULA ATP synthase D chain, mitochondr...    31   6.4
gi|17511189|ref|NP_492995.1| VAB-10B protein family member, Vari...    30   8.4
gi|10956337|ref|NP_052786.1| pXO1-90 [Bacillus anthracis] >gnl|B...    30   8.4
gi|17511187|ref|NP_492996.1| VAB-10B protein family member, Vari...    30   8.4
gi|7510925|pir||T26963 hypothetical protein ZK1151.2a - Caenorha...    30   8.4
gi|26343417|dbj|BAC35365.1| unnamed protein product [Mus musculus]     30   8.4
gi|26380847|dbj|BAB29542.2| unnamed protein product [Mus musculus]     30   8.4
gi|7510926|pir||T26964 hypothetical protein ZK1151.2b - Caenorha...    30   8.4
gi|2119281|pir||I48078 CHO1 antigen - Chinese hamster >gnl|BL_OR...    30   8.4
gi|27801760|emb|CAD44516.1| VAB-10B protein [Caenorhabditis eleg...    30   8.4
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo...    30   8.4
gi|19703951|ref|NP_603513.1| Hypothetical protein [Fusobacterium...    30   8.4
gi|50287147|ref|XP_446003.1| unnamed protein product [Candida gl...    30   8.4
gi|47218199|emb|CAF97063.1| unnamed protein product [Tetraodon n...    30   8.4
gi|33300472|emb|CAD90188.2| Hypothetical protein ZK1151.1c [Caen...    30   8.4
gi|34864667|ref|XP_236313.2| similar to Kinesin family member 23...    30   8.4
gi|50400509|sp|Q8BKE9|CCD2_MOUSE Coiled-coil domain containing p...    30   8.4
gi|41152227|ref|NP_958501.1| nudE nuclear distribution gene E ho...    30   8.4
gi|21397271|gb|AAM51835.1| Putative plant disease resistance pol...    30   8.4
gi|50405259|ref|YP_054351.1| Guanylate nucleotide binding protei...    30   8.4
gi|15613555|ref|NP_241858.1| transcriptional regulator [Bacillus...    30   8.4
gi|47568869|ref|ZP_00239562.1| S-layer homology domain protein [...    30   8.4
gi|31979146|gb|AAP68713.1| SabA [Helicobacter pylori]                  30   8.4
gi|27763989|emb|CAD44324.1| VAB-10B protein [Caenorhabditis eleg...    30   8.4
gi|1083998|pir||S51752 NSP3 protein - porcine rotavirus (strain ...    30   8.4
gi|32490842|ref|NP_871096.1| yceG [Wigglesworthia glossinidia en...    30   8.4
gi|15618970|ref|NP_225256.1| Exodoxyribonuclease VII [Chlamydoph...    30   8.4
gi|34876156|ref|XP_225336.2| similar to leucine rich repeat cont...    30   8.4
gi|29165807|gb|AAH49156.1| Unknown (protein for MGC:56922) [Mus ...    30   8.4
gi|47228961|emb|CAG09476.1| unnamed protein product [Tetraodon n...    30   8.4
gi|27370589|gb|AAH23760.1| Ccdc2 protein [Mus musculus]                30   8.4
gi|46520134|gb|AAT00455.1| occludin [Bos taurus]                       30   8.4
gi|12847975|dbj|BAB27780.1| unnamed protein product [Mus musculus]     30   8.4
gi|42521895|ref|NP_967275.1| preprotein translocase SecA subunit...    30   8.4


>gi|17544144|ref|NP_500967.1| phytoene dehydrogenase-like (15.0 kD)
           (4H99) [Caenorhabditis elegans]
 gi|15375271|gb|AAK95895.1| Hypothetical protein Y73B6BL.30
           [Caenorhabditis elegans]
          Length = 132

 Score =  223 bits (567), Expect = 9e-58
 Identities = 116/132 (87%), Positives = 116/132 (87%)
 Frame = +1

Query: 1   MAEINERXXXXXXXXXXXXXXXXHIRQLADNMTDKVGQFFQHQLEGSIEEYKLLETMNNT 180
           MAEINER                HIRQLADNMTDKVGQFFQHQLEGSIEEYKLLETMNNT
Sbjct: 1   MAEINERASTSSPPVPSTPAPVPHIRQLADNMTDKVGQFFQHQLEGSIEEYKLLETMNNT 60

Query: 181 TAQRYVDMKVVAEKVAGKLDNLNQKYENLRPYLSQIDAMDESTRRLEEATAVLENYVTQL 360
           TAQRYVDMKVVAEKVAGKLDNLNQKYENLRPYLSQIDAMDESTRRLEEATAVLENYVTQL
Sbjct: 61  TAQRYVDMKVVAEKVAGKLDNLNQKYENLRPYLSQIDAMDESTRRLEEATAVLENYVTQL 120

Query: 361 ESKLTNIQQQSQ 396
           ESKLTNIQQQSQ
Sbjct: 121 ESKLTNIQQQSQ 132




[DB home][top]