Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y74C10AR_2
(984 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25143635|ref|NP_490988.2| eukaryotic Initiation Factor (36.9 ... 681 0.0
gi|39595353|emb|CAE60390.1| Hypothetical protein CBG03991 [Caeno... 648 0.0
gi|17648041|ref|NP_523478.1| CG8882-PA [Drosophila melanogaster]... 315 1e-84
gi|48102488|ref|XP_392780.1| similar to CG8882-PA [Apis mellifera] 313 5e-84
gi|9055370|ref|NP_061269.1| eukaryotic translation initiation fa... 298 1e-79
gi|4503513|ref|NP_003748.1| eukaryotic translation initiation fa... 298 1e-79
gi|50759828|ref|XP_417800.1| PREDICTED: similar to Eukaryotic tr... 294 2e-78
gi|47229523|emb|CAF99511.1| unnamed protein product [Tetraodon n... 293 3e-78
gi|28279721|gb|AAH45995.1| Zgc:56211 protein [Danio rerio] >gnl|... 292 9e-78
gi|46443102|gb|EAL02386.1| hypothetical protein CaO19.10484 [Can... 279 8e-74
gi|38102524|gb|EAA49355.1| hypothetical protein MG01013.4 [Magna... 275 1e-72
gi|49091346|ref|XP_407134.1| hypothetical protein AN2997.2 [Aspe... 274 3e-72
gi|31248060|ref|XP_316636.1| ENSANGP00000011568 [Anopheles gambi... 272 7e-72
gi|32405164|ref|XP_323195.1| hypothetical protein [Neurospora cr... 268 1e-70
gi|46137505|ref|XP_390444.1| conserved hypothetical protein [Gib... 268 2e-70
gi|50420533|ref|XP_458803.1| unnamed protein product [Debaryomyc... 266 4e-70
gi|6323795|ref|NP_013866.1| Subunit of the core complex of trans... 266 4e-70
gi|50293335|ref|XP_449079.1| unnamed protein product [Candida gl... 265 1e-69
gi|34015219|gb|AAQ56413.1| putative TGF-beta receptor-interactin... 261 2e-68
gi|50310787|ref|XP_455416.1| unnamed protein product [Kluyveromy... 260 4e-68
gi|50543074|ref|XP_499703.1| hypothetical protein [Yarrowia lipo... 259 7e-68
gi|13936812|gb|AAK49947.1| TGF-beta receptor-interacting protein... 256 7e-67
gi|50260567|gb|EAL23222.1| hypothetical protein CNBA5660 [Crypto... 255 9e-67
gi|15225954|ref|NP_182151.1| eukaryotic translation initiation f... 246 6e-64
gi|13877569|gb|AAK43862.1| eukaryotic translation initiation fac... 245 1e-63
gi|11279189|pir||T42745 hypothetical protein - fission yeast (Sc... 244 2e-63
gi|19115870|ref|NP_594958.1| eukaryotic translation initiation f... 244 2e-63
gi|25313270|pir||A84901 hypothetical protein At2g46290 [imported... 244 2e-63
gi|30690306|ref|NP_182152.2| eukaryotic translation initiation f... 244 2e-63
gi|26452892|dbj|BAC43524.1| putative eukaryotic translation init... 244 2e-63
gi|12407664|gb|AAG53616.1| eukaryotic initiation factor 3I1 subu... 238 2e-61
gi|45188137|ref|NP_984360.1| ADR264Cp [Eremothecium gossypii] >g... 236 6e-61
gi|2129749|pir||S60256 TGF-beta receptor interacting protein 1 h... 236 8e-61
gi|49075790|ref|XP_401936.1| hypothetical protein UM04321.1 [Ust... 218 2e-55
gi|38090987|ref|XP_125917.2| RIKEN cDNA 4930503E24 [Mus musculus] 199 6e-50
gi|37962706|gb|AAR05659.1| translation initiation factor 34 [Try... 179 7e-44
gi|42571247|ref|NP_973697.1| eukaryotic translation initiation f... 163 6e-39
gi|38048639|gb|AAR10222.1| similar to Drosophila melanogaster Tr... 159 7e-38
gi|23612540|ref|NP_704101.1| eukaryotic translation initiation f... 146 6e-34
gi|23480608|gb|EAA17122.1| eukaryotic translation initiation fac... 144 2e-33
gi|32394628|gb|AAM94012.1| TGF-beta receptor-interacting protein... 134 2e-30
gi|19074631|ref|NP_586137.1| TRANSLATION INITIATION FACTOR IF3 S... 132 1e-29
gi|34856958|ref|XP_342250.1| similar to Eukaryotic translation i... 123 7e-27
gi|50729050|ref|XP_416406.1| PREDICTED: similar to UNR-interacti... 121 2e-26
gi|12667270|gb|AAK01368.1| serine-threonine kinase receptor-asso... 120 5e-26
gi|41053501|ref|NP_956598.1| serine/threonine kinase receptor as... 119 8e-26
gi|48122105|ref|XP_396504.1| similar to ENSANGP00000003345 [Apis... 117 5e-25
gi|34858563|ref|XP_216287.2| similar to UNR-interacting protein ... 116 7e-25
gi|6755682|ref|NP_035629.1| serine/threonine kinase receptor ass... 116 9e-25
gi|26344646|dbj|BAC35972.1| unnamed protein product [Mus musculus] 116 9e-25
gi|4519417|dbj|BAA75544.1| WD-40 repeat protein [Homo sapiens] 115 1e-24
gi|20149592|ref|NP_009109.2| serine/threonine kinase receptor as... 115 1e-24
gi|26346366|dbj|BAC36834.1| unnamed protein product [Mus musculus] 115 1e-24
gi|12643951|sp|Q9Y3F4|STRA_HUMAN Serine-threonine kinase recepto... 115 1e-24
gi|31209853|ref|XP_313893.1| ENSANGP00000003345 [Anopheles gambi... 115 2e-24
gi|31209851|ref|XP_313892.1| ENSANGP00000021722 [Anopheles gambi... 115 2e-24
gi|19922822|ref|NP_611804.1| CG3957-PA [Drosophila melanogaster]... 113 6e-24
gi|18394249|ref|NP_563978.1| transducin family protein / WD-40 r... 110 6e-23
gi|50555461|ref|XP_505139.1| hypothetical protein [Yarrowia lipo... 105 1e-21
gi|18400838|ref|NP_566519.1| transducin family protein / WD-40 r... 102 2e-20
gi|47217231|emb|CAF96754.1| unnamed protein product [Tetraodon n... 101 3e-20
gi|30695318|ref|NP_849800.1| transducin family protein / WD-40 r... 100 5e-20
gi|46390530|dbj|BAD16018.1| putative serine-threonine kinase rec... 99 1e-19
gi|49111850|ref|XP_411842.1| hypothetical protein AN7705.2 [Aspe... 98 3e-19
gi|50259703|gb|EAL22373.1| hypothetical protein CNBB5460 [Crypto... 95 2e-18
gi|50725469|dbj|BAD32940.1| putative WD-40 repeat protein [Oryza... 95 3e-18
gi|7959893|gb|AAF71117.1| PRO2242 [Homo sapiens] 94 5e-18
gi|37546997|ref|XP_293026.3| similar to UNR-interacting protein ... 93 1e-17
gi|50252234|dbj|BAD28241.1| putative WD repeat domain 5B [Oryza ... 92 2e-17
gi|23128236|ref|ZP_00110089.1| COG2319: FOG: WD40 repeat [Nostoc... 91 4e-17
gi|27666788|ref|XP_221406.1| similar to WD repeat domain 5B [Rat... 90 9e-17
gi|48891324|ref|ZP_00324864.1| COG2319: FOG: WD40 repeat [Tricho... 89 1e-16
gi|45525517|ref|ZP_00176748.1| COG2319: FOG: WD40 repeat [Crocos... 89 2e-16
gi|48893580|ref|ZP_00326778.1| COG2319: FOG: WD40 repeat [Tricho... 89 2e-16
gi|20091353|ref|NP_617428.1| WD40-repeat containing protein [Met... 88 3e-16
gi|3023956|sp|Q00808|HET1_PODAN Vegetatible incompatibility prot... 88 3e-16
gi|20892399|ref|XP_148059.1| expressed sequence AI606931 [Mus mu... 88 3e-16
gi|23128312|ref|ZP_00110163.1| COG2319: FOG: WD40 repeat [Nostoc... 88 3e-16
gi|48894805|ref|ZP_00327914.1| COG2319: FOG: WD40 repeat [Tricho... 87 6e-16
gi|17230283|ref|NP_486831.1| WD-repeat protein [Nostoc sp. PCC 7... 86 1e-15
gi|38101352|gb|EAA48329.1| hypothetical protein MG10588.4 [Magna... 86 1e-15
gi|17228160|ref|NP_484708.1| WD-40 repeat protein [Nostoc sp. PC... 86 2e-15
gi|17225204|gb|AAL37298.1| beta transducin-like protein HET-E2C ... 85 2e-15
gi|17225208|gb|AAL37300.1| beta transducin-like protein HET-E2C*... 85 2e-15
gi|33417154|gb|AAH56099.1| MGC69111 protein [Xenopus laevis] 85 2e-15
gi|50754099|ref|XP_414244.1| PREDICTED: similar to DKFZP434C245 ... 85 3e-15
gi|30353827|gb|AAH52124.1| Zgc:76895 protein [Danio rerio] >gnl|... 84 5e-15
gi|17225206|gb|AAL37299.1| beta transducin-like protein HET-E2C*... 84 6e-15
gi|46111861|ref|XP_382988.1| hypothetical protein FG02812.1 [Gib... 83 8e-15
gi|50416345|gb|AAH77844.1| Unknown (protein for MGC:80538) [Xeno... 83 1e-14
gi|16554627|ref|NP_060058.1| WD repeat domain 5 protein; WD-repe... 83 1e-14
gi|50757207|ref|XP_415427.1| PREDICTED: similar to Zgc:56591 pro... 83 1e-14
gi|6714707|emb|CAB66159.1| hypothetical protein [Homo sapiens] 83 1e-14
gi|34853150|ref|XP_342398.1| similar to hypothetical protein [Ra... 83 1e-14
gi|18424859|ref|NP_568993.1| transducin family protein / WD-40 r... 82 1e-14
gi|23124949|ref|ZP_00106905.1| COG2319: FOG: WD40 repeat [Nostoc... 82 2e-14
gi|48893630|ref|ZP_00326828.1| COG2319: FOG: WD40 repeat [Tricho... 82 2e-14
gi|20302740|gb|AAM18868.1| unknown [Branchiostoma floridae] 82 2e-14
gi|48838134|ref|ZP_00295082.1| COG2319: FOG: WD40 repeat [Methan... 82 2e-14
gi|17505659|ref|NP_491325.1| u5 snRNP-specific protein (36.8 kD)... 82 2e-14
gi|7023854|dbj|BAA92110.1| unnamed protein product [Homo sapiens] 82 2e-14
gi|31196347|ref|XP_307121.1| ENSANGP00000012135 [Anopheles gambi... 82 2e-14
gi|17230958|ref|NP_487506.1| WD-40 repeat protein [Nostoc sp. PC... 81 3e-14
gi|45508168|ref|ZP_00160508.1| COG2319: FOG: WD40 repeat [Anabae... 81 3e-14
gi|40949819|gb|AAR97571.1| will die slowly [Bombyx mori] 81 3e-14
gi|23199987|ref|NP_061942.2| WD repeat domain 5B [Homo sapiens] ... 81 3e-14
gi|45506973|ref|ZP_00159321.1| COG2319: FOG: WD40 repeat [Anabae... 81 3e-14
gi|17227525|ref|NP_484073.1| WD-40 repeat protein [Nostoc sp. PC... 81 4e-14
gi|47229875|emb|CAG07071.1| unnamed protein product [Tetraodon n... 81 4e-14
gi|46134381|ref|ZP_00157805.2| COG2319: FOG: WD40 repeat [Anabae... 80 5e-14
gi|21674797|ref|NP_662862.1| WD-repeat family protein [Chlorobiu... 80 5e-14
gi|29247502|gb|EAA39062.1| GLP_21_36440_35388 [Giardia lamblia A... 80 5e-14
gi|46135357|ref|ZP_00162759.2| COG2319: FOG: WD40 repeat [Anabae... 80 9e-14
gi|17232326|ref|NP_488874.1| WD-repeat protein [Nostoc sp. PCC 7... 80 9e-14
gi|45506782|ref|ZP_00159132.1| COG2319: FOG: WD40 repeat [Anabae... 79 1e-13
gi|49073468|ref|XP_400951.1| hypothetical protein UM03336.1 [Ust... 79 1e-13
gi|23130132|ref|ZP_00111951.1| COG2319: FOG: WD40 repeat [Nostoc... 79 2e-13
gi|46135387|ref|ZP_00162792.2| COG2319: FOG: WD40 repeat [Anabae... 79 2e-13
gi|37521534|ref|NP_924911.1| WD-repeat protein [Gloeobacter viol... 79 2e-13
gi|23128981|ref|ZP_00110817.1| COG2319: FOG: WD40 repeat [Nostoc... 78 3e-13
gi|23126059|ref|ZP_00107968.1| COG2319: FOG: WD40 repeat [Nostoc... 78 3e-13
gi|45505417|ref|ZP_00157801.1| COG2319: FOG: WD40 repeat [Anabae... 78 3e-13
gi|39594799|emb|CAE70667.1| Hypothetical protein CBG17375 [Caeno... 78 4e-13
gi|17864654|ref|NP_524984.1| CG17437-PA [Drosophila melanogaster... 77 5e-13
gi|49124494|ref|XP_412605.1| hypothetical protein AN8468.2 [Aspe... 77 5e-13
gi|23130298|ref|ZP_00112115.1| COG2319: FOG: WD40 repeat [Nostoc... 77 6e-13
gi|32264056|gb|AAO45688.1| activated protein kinase C receptor [... 77 6e-13
gi|23124360|ref|ZP_00106355.1| COG2319: FOG: WD40 repeat [Nostoc... 77 6e-13
gi|17551498|ref|NP_509886.1| u5 snRNP-specific protein (XL916) [... 77 8e-13
gi|28630241|gb|AAM88903.1| guanine nucleotide-binding protein [M... 76 1e-12
gi|22028422|gb|AAH34901.1| 2510040D07Rik protein [Mus musculus] 76 1e-12
gi|23593529|ref|XP_135092.2| RIKEN cDNA 2510040D07 [Mus musculus] 76 1e-12
gi|23479901|gb|EAA16609.1| hypothetical protein [Plasmodium yoel... 75 2e-12
gi|12846941|dbj|BAB27371.1| unnamed protein product [Mus musculus] 75 2e-12
gi|41056233|ref|NP_956412.1| Unknown (protein for MGC:63538); wu... 75 2e-12
gi|13938537|gb|AAH07417.1| DKFZP434C245 protein [Homo sapiens] 75 2e-12
gi|47214359|emb|CAG01204.1| unnamed protein product [Tetraodon n... 75 2e-12
gi|31377770|ref|NP_056241.2| DKFZP434C245 protein [Homo sapiens]... 75 3e-12
gi|37682095|gb|AAQ97974.1| TUWD12 [Danio rerio] 74 4e-12
gi|17233145|ref|NP_490235.1| WD-repeat protein [Nostoc sp. PCC 7... 74 4e-12
gi|1346729|sp|P49695|PKWA_THECU Probable serine/threonine-protei... 74 4e-12
gi|50728412|ref|XP_416132.1| PREDICTED: similar to TUWD12 [Gallu... 74 4e-12
gi|48835147|ref|ZP_00292148.1| COG2319: FOG: WD40 repeat [Thermo... 74 4e-12
gi|23612749|ref|NP_704288.1| guanine nucleotide-binding protein,... 74 4e-12
gi|121026|sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protei... 74 5e-12
gi|17227780|ref|NP_484328.1| WD-40 repeat protein [Nostoc sp. PC... 74 5e-12
gi|27371211|gb|AAH41541.1| Gnb2l1-prov protein [Xenopus laevis] 73 9e-12
gi|16306637|gb|AAH01494.1| U5 snRNP-specific 40 kDa protein (hPr... 73 1e-11
gi|23130558|ref|ZP_00112371.1| COG2319: FOG: WD40 repeat [Nostoc... 73 1e-11
gi|45508332|ref|ZP_00160671.1| COG2319: FOG: WD40 repeat [Anabae... 73 1e-11
gi|47900542|gb|AAT39277.1| putative guanine nucleotide-binding p... 73 1e-11
gi|17227934|ref|NP_484482.1| serine/threonine kinase with WD-40 ... 72 1e-11
gi|42733993|gb|AAO52600.2| similar to Arabidopsis thaliana (Mous... 72 1e-11
gi|15229187|ref|NP_190535.1| transducin family protein / WD-40 r... 72 1e-11
gi|37231578|gb|AAH58365.1| Prp8bp-pending protein [Mus musculus] 72 1e-11
gi|4758560|ref|NP_004805.1| U5 snRNP-specific 40 kDa protein (hP... 72 2e-11
gi|23124439|ref|ZP_00106428.1| COG2319: FOG: WD40 repeat [Nostoc... 72 2e-11
gi|49523265|gb|AAH75435.1| Unknown (protein for MGC:89209) [Xeno... 72 2e-11
gi|32409157|ref|XP_325059.1| hypothetical protein [Neurospora cr... 72 2e-11
gi|48100231|ref|XP_392611.1| similar to TUWD12 [Apis mellifera] 72 2e-11
gi|45509405|ref|ZP_00161739.1| COG2319: FOG: WD40 repeat [Anabae... 72 3e-11
gi|50759611|ref|XP_417704.1| PREDICTED: similar to Prp8bp-pendin... 72 3e-11
gi|45361545|ref|NP_989349.1| hypothetical protein MGC76247 [Xeno... 72 3e-11
gi|10177204|dbj|BAB10306.1| unnamed protein product [Arabidopsis... 71 3e-11
gi|28630243|gb|AAM88904.1| guanine nucleotide-binding protein [P... 71 3e-11
gi|7496291|pir||T15181 hypothetical protein C18E3.5 - Caenorhabd... 71 4e-11
gi|37523920|ref|NP_927297.1| WD-repeat protein [Gloeobacter viol... 71 4e-11
gi|5326785|gb|AAD42045.1| activated protein kinase C receptor; R... 71 4e-11
gi|3023850|sp|O42249|GBLP_ORENI Guanine nucleotide-binding prote... 71 4e-11
gi|37498964|gb|AAQ91574.1| receptor for activated protein kinase... 71 4e-11
gi|17225210|gb|AAL37301.1| beta transducin-like protein HET-D2Y ... 71 4e-11
gi|12856025|dbj|BAB30542.1| unnamed protein product [Mus musculu... 70 6e-11
gi|11992988|gb|AAA56865.2| guanine nucleotide regulatory protein... 70 6e-11
gi|19114682|ref|NP_593770.1| guanine nucleotide-binding protein ... 70 6e-11
gi|30585331|gb|AAP36938.1| Homo sapiens guanine nucleotide bindi... 70 6e-11
gi|49523068|gb|AAH75548.1| Unknown (protein for MGC:89488) [Xeno... 70 6e-11
gi|37522390|ref|NP_925767.1| WD-repeat protein [Gloeobacter viol... 70 6e-11
gi|47059149|ref|NP_082016.1| similar to TUWD12 [Mus musculus] >g... 70 6e-11
gi|23126805|ref|ZP_00108691.1| COG2319: FOG: WD40 repeat [Nostoc... 70 6e-11
gi|47085759|ref|NP_998214.1| zgc:56055 [Danio rerio] >gnl|BL_ORD... 70 6e-11
gi|18543331|ref|NP_570090.1| guanine nucleotide binding protein,... 70 6e-11
gi|5174447|ref|NP_006089.1| guanine nucleotide binding protein (... 70 6e-11
gi|17230611|ref|NP_487159.1| WD repeat protein with Ser/Thr prot... 70 7e-11
gi|48894319|ref|ZP_00327428.1| COG2319: FOG: WD40 repeat [Tricho... 70 7e-11
gi|47570890|gb|AAT35603.1| receptor for activated protein kinase... 70 7e-11
gi|39580327|emb|CAE64482.1| Hypothetical protein CBG09206 [Caeno... 70 7e-11
gi|15235470|ref|NP_192182.1| transducin family protein / WD-40 r... 70 1e-10
gi|23129632|ref|ZP_00111458.1| COG2319: FOG: WD40 repeat [Nostoc... 70 1e-10
gi|47224493|emb|CAG08743.1| unnamed protein product [Tetraodon n... 70 1e-10
gi|37521199|ref|NP_924576.1| WD-40 repeat protein [Gloeobacter v... 69 1e-10
gi|39586335|emb|CAE66746.1| Hypothetical protein CBG12096 [Caeno... 69 1e-10
gi|23129722|ref|ZP_00111547.1| COG2319: FOG: WD40 repeat [Nostoc... 69 1e-10
gi|17229616|ref|NP_486164.1| WD-40 repeat protein [Nostoc sp. PC... 69 1e-10
gi|18859301|ref|NP_571519.1| guanine nucleotide binding protein ... 69 1e-10
gi|32189425|ref|NP_849143.1| hypothetical protein FLJ25955 [Homo... 69 1e-10
gi|46134602|ref|ZP_00158196.2| COG2319: FOG: WD40 repeat [Anabae... 69 2e-10
gi|41724850|ref|ZP_00151660.1| COG2319: FOG: WD40 repeat [Dechlo... 69 2e-10
gi|46134549|ref|ZP_00158076.2| COG2319: FOG: WD40 repeat [Anabae... 69 2e-10
gi|15224356|ref|NP_181905.1| transducin family protein / WD-40 r... 69 2e-10
gi|2494908|sp|Q25189|GBLP_HYDAT Guanine nucleotide-binding prote... 69 2e-10
gi|46120249|ref|ZP_00179648.2| COG2319: FOG: WD40 repeat [Crocos... 69 2e-10
gi|28630245|gb|AAM88905.1| guanine nucleotide-binding protein [S... 69 2e-10
gi|26665869|ref|NP_758440.1| TUWD12 [Homo sapiens] >gnl|BL_ORD_I... 69 2e-10
gi|11346447|pir||T43158 probable GTP-binding protein beta chain ... 69 2e-10
gi|23126094|ref|ZP_00108001.1| COG2319: FOG: WD40 repeat [Nostoc... 68 3e-10
gi|50751998|ref|XP_422608.1| PREDICTED: similar to hypothetical ... 68 3e-10
gi|475012|dbj|BAA06185.1| G protein beta subuit like [Mus musculus] 68 3e-10
gi|17232051|ref|NP_488599.1| WD-40 repeat-protein [Nostoc sp. PC... 68 3e-10
gi|18139935|gb|AAL60198.1| WD40-repeat-containing protein [Chlam... 68 4e-10
gi|46119952|ref|ZP_00179225.2| COG2319: FOG: WD40 repeat [Crocos... 68 4e-10
gi|45509197|ref|ZP_00161532.1| COG2319: FOG: WD40 repeat [Anabae... 68 4e-10
gi|41053421|ref|NP_956616.1| similar to U5 snRNP-specific 40 kDa... 68 4e-10
gi|21758953|dbj|BAC05425.1| unnamed protein product [Homo sapiens] 68 4e-10
gi|12848861|dbj|BAB28114.1| unnamed protein product [Mus musculus] 68 4e-10
gi|45508311|ref|ZP_00160650.1| COG2319: FOG: WD40 repeat [Anabae... 67 5e-10
gi|37520294|ref|NP_923671.1| WD-40 repeat protein [Gloeobacter v... 67 5e-10
gi|37779072|gb|AAP20196.1| activated protein kinase C receptor [... 67 5e-10
gi|17230292|ref|NP_486840.1| WD-repeat protein [Nostoc sp. PCC 7... 67 5e-10
gi|45509691|ref|ZP_00162024.1| COG2319: FOG: WD40 repeat [Anabae... 67 5e-10
gi|50259040|gb|EAL21719.1| hypothetical protein CNBC5830 [Crypto... 67 6e-10
gi|13812424|ref|NP_113542.1| guanine nucleotide-binding protein ... 67 6e-10
gi|30025862|gb|AAP04406.1| G-protein beta subunit like-protein [... 67 6e-10
gi|23124810|ref|ZP_00106776.1| COG2319: FOG: WD40 repeat [Nostoc... 67 8e-10
gi|18202857|sp|Q9DC48|PR17_MOUSE Pre-mRNA splicing factor PRP17 ... 67 8e-10
gi|50421219|ref|XP_459155.1| unnamed protein product [Debaryomyc... 67 8e-10
gi|23130638|ref|ZP_00112451.1| COG2319: FOG: WD40 repeat [Nostoc... 67 8e-10
gi|34852890|ref|XP_342155.1| similar to Pre-mRNA splicing factor... 67 8e-10
gi|48895476|ref|ZP_00328460.1| COG2319: FOG: WD40 repeat [Tricho... 66 1e-09
gi|44965061|gb|AAS49532.1| guanine nucleotide binding protein be... 66 1e-09
gi|3283220|gb|AAC25166.1| splicing factor hPRP17 [Homo sapiens] 66 1e-09
gi|7706657|ref|NP_056975.1| pre-mRNA splicing factor 17; EH-bind... 66 1e-09
gi|46134601|ref|ZP_00158195.2| COG2319: FOG: WD40 repeat [Anabae... 66 1e-09
gi|21222277|ref|NP_628056.1| putative WD-40 repeat protein [Stre... 66 1e-09
gi|50308531|ref|XP_454268.1| unnamed protein product [Kluyveromy... 66 1e-09
gi|23125398|ref|ZP_00107333.1| COG2319: FOG: WD40 repeat [Nostoc... 66 1e-09
gi|17227743|ref|NP_484291.1| WD-40 repeat protein [Nostoc sp. PC... 66 1e-09
gi|7479150|pir||T42045 beta transducin-like protein homolog - St... 65 2e-09
gi|31236053|ref|XP_319347.1| ENSANGP00000012560 [Anopheles gambi... 65 2e-09
gi|2494906|sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding prote... 65 2e-09
gi|17227779|ref|NP_484327.1| WD-40 repeat protein [Nostoc sp. PC... 65 2e-09
gi|47216142|emb|CAG10016.1| unnamed protein product [Tetraodon n... 65 2e-09
gi|30024660|gb|AAP13580.1| guanine nucleotide binding protein be... 65 2e-09
gi|12854841|dbj|BAB30146.1| unnamed protein product [Mus musculus] 65 2e-09
gi|47209012|emb|CAF91370.1| unnamed protein product [Tetraodon n... 65 2e-09
gi|37521813|ref|NP_925190.1| WD-repeat protein [Gloeobacter viol... 65 2e-09
gi|50425399|ref|XP_461293.1| unnamed protein product [Debaryomyc... 65 2e-09
gi|50539926|ref|NP_001002429.1| zgc:92654 [Danio rerio] >gnl|BL_... 65 3e-09
gi|31202483|ref|XP_310190.1| ENSANGP00000010898 [Anopheles gambi... 65 3e-09
gi|13027436|ref|NP_076469.1| apoptotic protease activating facto... 65 3e-09
gi|17224297|gb|AAL36935.1| apoptotic protease activating factor-... 65 3e-09
gi|21313414|ref|NP_079921.1| U5 snRNP-specific protein (Prp8-bin... 64 4e-09
gi|49134361|ref|XP_413222.1| hypothetical protein AN9085.2 [Aspe... 64 4e-09
gi|1722837|sp|P54686|WD42_DICDI WD-repeat protein 2 >gnl|BL_ORD_... 64 4e-09
gi|28828113|gb|AAO50796.1| similar to Anabaena sp. (strain PCC 7... 64 4e-09
gi|50556994|ref|XP_505905.1| hypothetical protein [Yarrowia lipo... 64 4e-09
gi|17225202|gb|AAL37297.1| beta transducin-like protein HET-E4s ... 64 4e-09
gi|16331266|ref|NP_441994.1| beta transducin-like protein [Synec... 64 4e-09
gi|6857755|ref|NP_033814.1| apoptotic protease activating factor... 64 4e-09
gi|37523925|ref|NP_927302.1| WD-repeat protein [Gloeobacter viol... 64 4e-09
gi|20137267|sp|O88879|APAF_MOUSE Apoptotic protease activating f... 64 4e-09
gi|23129032|ref|ZP_00110866.1| COG2319: FOG: WD40 repeat [Nostoc... 64 4e-09
gi|38104383|gb|EAA50960.1| hypothetical protein MG04719.4 [Magna... 64 4e-09
gi|47208427|emb|CAF87494.1| unnamed protein product [Tetraodon n... 64 5e-09
gi|34534989|dbj|BAC87175.1| unnamed protein product [Homo sapiens] 64 5e-09
gi|31223622|ref|XP_317330.1| ENSANGP00000010549 [Anopheles gambi... 64 5e-09
gi|23126612|ref|ZP_00108502.1| COG2319: FOG: WD40 repeat [Nostoc... 64 5e-09
gi|46134639|ref|ZP_00158286.2| COG2319: FOG: WD40 repeat [Anabae... 64 5e-09
gi|45507426|ref|ZP_00159770.1| COG2319: FOG: WD40 repeat [Anabae... 64 7e-09
gi|37522457|ref|NP_925834.1| WD-repeat protein [Gloeobacter viol... 64 7e-09
gi|19071249|gb|AAL84173.1| receptor for activated PKC [Schistoso... 64 7e-09
gi|49091992|ref|XP_407457.1| hypothetical protein AN3320.2 [Aspe... 64 7e-09
gi|23129645|ref|ZP_00111471.1| COG2319: FOG: WD40 repeat [Nostoc... 63 9e-09
gi|39582675|emb|CAE73779.1| Hypothetical protein CBG21324 [Caeno... 63 9e-09
gi|16331137|ref|NP_441865.1| beta transducin-like protein [Synec... 63 9e-09
gi|24663767|ref|NP_648640.1| CG10191-PA [Drosophila melanogaster... 63 9e-09
gi|50255120|gb|EAL17859.1| hypothetical protein CNBL1210 [Crypto... 63 1e-08
gi|48846051|ref|ZP_00300319.1| COG2319: FOG: WD40 repeat [Geobac... 63 1e-08
gi|18858279|ref|NP_571683.1| apoptotic protease activating facto... 63 1e-08
gi|23123730|ref|ZP_00105782.1| COG2319: FOG: WD40 repeat [Nostoc... 62 2e-08
gi|24645024|ref|NP_649784.1| CG9615-PA [Drosophila melanogaster]... 62 2e-08
gi|45509331|ref|ZP_00161665.1| COG2319: FOG: WD40 repeat [Anabae... 62 2e-08
gi|21430078|gb|AAM50717.1| GM21396p [Drosophila melanogaster] 62 2e-08
gi|17555002|ref|NP_498096.1| nuclear matrix protein SNEV (3G260)... 62 2e-08
gi|50294225|ref|XP_449524.1| unnamed protein product [Candida gl... 62 2e-08
gi|50744592|ref|XP_419790.1| PREDICTED: similar to Pre-mRNA spli... 62 2e-08
gi|3746838|gb|AAC64084.1| 38kDa splicing factor; SPF 38 [Homo sa... 62 2e-08
gi|49102841|ref|XP_411097.1| hypothetical protein AN6960.2 [Aspe... 62 3e-08
gi|2290597|gb|AAB72148.1| RACK1 [Drosophila melanogaster] 62 3e-08
gi|17137396|ref|NP_477269.1| CG7111-PA [Drosophila melanogaster]... 62 3e-08
gi|46135416|ref|ZP_00203492.1| COG2319: FOG: WD40 repeat [Anabae... 62 3e-08
gi|27924436|gb|AAH45034.1| Prp8bp-pending-prov protein [Xenopus ... 62 3e-08
gi|3859574|gb|AAC72850.1| activated protein kinase C receptor ho... 62 3e-08
gi|32822805|gb|AAH54992.1| MGC64565 protein [Xenopus laevis] 61 3e-08
gi|34852338|ref|XP_228058.2| similar to axonemal dynein heavy ch... 61 3e-08
gi|45508715|ref|ZP_00161052.1| COG2319: FOG: WD40 repeat [Anabae... 61 3e-08
gi|28279515|gb|AAH45316.1| Denticleless homolog [Danio rerio] 61 3e-08
gi|27545239|ref|NP_775348.1| denticleless homolog [Danio rerio] ... 61 3e-08
gi|17227974|ref|NP_484522.1| WD-40 repeat protein [Nostoc sp. PC... 61 3e-08
gi|17488592|gb|AAL40359.1| unknown protein [Takifugu rubripes] 61 4e-08
gi|46561762|gb|AAT01086.1| putative activated protein kinase C r... 61 4e-08
gi|22129772|ref|NP_078808.2| PF20; sperm-associated WD repeat pr... 61 4e-08
gi|46136709|ref|XP_390046.1| GBLP_NEUCR Guanine nucleotide-bindi... 61 4e-08
gi|48892224|ref|ZP_00325622.1| COG2319: FOG: WD40 repeat [Tricho... 61 4e-08
gi|48840987|ref|ZP_00297913.1| COG2319: FOG: WD40 repeat [Methan... 60 6e-08
gi|34855811|ref|XP_218509.2| hypothetical protein XP_218509 [Rat... 60 6e-08
gi|23955935|gb|AAN40696.1| RACK1-like protein [Paracoccidioides ... 60 6e-08
gi|3023852|sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding prote... 60 6e-08
gi|24210418|emb|CAD54457.1| LIS1 protein [Dictyostelium discoide... 60 6e-08
gi|3023851|sp|P93340|GBLP_NICPL Guanine nucleotide-binding prote... 60 6e-08
gi|5051805|emb|CAB45034.1| putative WD-repeat containing protein... 60 8e-08
gi|25402606|pir||C86239 protein T10O24.21 [imported] - Arabidops... 60 8e-08
gi|17230661|ref|NP_487209.1| WD repeat protein with Ser/Thr prot... 60 8e-08
gi|17233117|ref|NP_490207.1| WD-repeat protein [Nostoc sp. PCC 7... 60 8e-08
gi|45433584|ref|NP_991399.1| hypothetical protein MGC76037 [Xeno... 60 8e-08
gi|34864785|ref|XP_343203.1| similar to TUWD12 [Rattus norvegicus] 60 8e-08
gi|20091406|ref|NP_617481.1| WD-domain containing protein [Metha... 60 8e-08
gi|30681779|ref|NP_172528.2| transducin family protein / WD-40 r... 60 8e-08
gi|49093204|ref|XP_408063.1| hypothetical protein AN3926.2 [Aspe... 60 1e-07
gi|881422|gb|AAA70100.1| G beta like protein 60 1e-07
gi|25402650|pir||E86245 hypothetical protein [imported] - Arabid... 60 1e-07
gi|50409865|ref|XP_456913.1| unnamed protein product [Debaryomyc... 60 1e-07
gi|48104663|ref|XP_392962.1| similar to putative activated prote... 59 1e-07
gi|32410369|ref|XP_325665.1| hypothetical protein [Neurospora cr... 59 1e-07
gi|14132774|gb|AAK52334.1| LIS1 [Xenopus laevis] 59 1e-07
gi|47224591|emb|CAG03575.1| unnamed protein product [Tetraodon n... 59 1e-07
gi|7446126|pir||T16970 GTP-binding protein beta chain homolog - ... 59 2e-07
gi|38258921|sp|P46800|GBLP_DICDI Guanine nucleotide-binding prot... 59 2e-07
gi|39586585|emb|CAE73712.1| Hypothetical protein CBG21225 [Caeno... 59 2e-07
gi|47214100|emb|CAF95357.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|1346110|sp|P49026|GBLP_TOBAC Guanine nucleotide-binding prote... 59 2e-07
gi|49098364|ref|XP_410642.1| hypothetical protein AN6505.2 [Aspe... 59 2e-07
gi|48893749|ref|ZP_00326947.1| COG2319: FOG: WD40 repeat [Tricho... 59 2e-07
gi|38104352|gb|EAA50934.1| hypothetical protein MG04693.4 [Magna... 59 2e-07
gi|7492063|pir||T41075 hypothetical WD-repeat protein SPCC16A11.... 59 2e-07
gi|45508310|ref|ZP_00160649.1| COG2319: FOG: WD40 repeat [Anabae... 59 2e-07
gi|11093957|gb|AAG29506.1| activated protein kinase C receptor [... 59 2e-07
gi|19113046|ref|NP_596254.1| transcription initiation factor TFI... 59 2e-07
gi|46130702|ref|XP_389131.1| hypothetical protein FG08955.1 [Gib... 58 3e-07
gi|34877003|ref|XP_343610.1| similar to RIKEN cDNA 4933429D11 [R... 58 3e-07
gi|34894702|ref|NP_908676.1| P0426D06.17 [Oryza sativa (japonica... 58 3e-07
gi|19112136|ref|NP_595344.1| WD repeat protein [Schizosaccharomy... 58 3e-07
gi|50309993|ref|XP_455010.1| unnamed protein product [Kluyveromy... 58 3e-07
gi|50551767|ref|XP_503358.1| hypothetical protein [Yarrowia lipo... 58 3e-07
gi|21313046|ref|NP_082001.1| RIKEN cDNA 4933429D11 [Mus musculus... 58 4e-07
gi|49093678|ref|XP_408300.1| GBLP_NEUCR Guanine nucleotide-bindi... 58 4e-07
gi|48891596|ref|ZP_00325089.1| COG0515: Serine/threonine protein... 58 4e-07
gi|46111533|ref|XP_382824.1| hypothetical protein FG02648.1 [Gib... 58 4e-07
gi|32473597|ref|NP_866591.1| putative WD-repeat containing prote... 58 4e-07
gi|4589836|dbj|BAA76896.1| LeArcA2 protein [Lycopersicon esculen... 58 4e-07
gi|45187689|ref|NP_983912.1| ADL184Wp [Eremothecium gossypii] >g... 58 4e-07
gi|42733968|gb|AAS38868.1| similar to Homo sapiens (Human). DKFZ... 57 5e-07
gi|36958731|gb|AAQ87199.1| Vegetatible incompatibility protein H... 57 5e-07
gi|17554220|ref|NP_499755.1| human LISsencephaly gene related (4... 57 5e-07
gi|45198717|ref|NP_985746.1| AFR199Cp [Eremothecium gossypii] >g... 57 5e-07
gi|34871679|ref|XP_232775.2| similar to U5 snRNP-specific protei... 57 5e-07
gi|29247640|gb|EAA39196.1| GLP_160_23307_22402 [Giardia lamblia ... 57 5e-07
gi|4589834|dbj|BAA76895.1| LeArcA1 protein [Lycopersicon esculen... 57 5e-07
gi|38086505|ref|XP_356350.1| similar to WD repeat domain 9 isofo... 57 5e-07
gi|37522224|ref|NP_925601.1| WD-repeat protein [Gloeobacter viol... 57 6e-07
gi|6319651|ref|NP_009734.1| Subunit of the COMPASS complex, whic... 57 6e-07
gi|19113627|ref|NP_596835.1| WD repeat protein; human U5 SNRNP-s... 57 6e-07
gi|23490090|gb|EAA21947.1| hypothetical protein [Plasmodium yoel... 57 6e-07
gi|3122601|sp|P93107|PF20_CHLRE Flagellar WD-repeat protein PF20... 57 6e-07
gi|11066216|gb|AAG28504.1| TUPA [Emericella nidulans] 57 6e-07
gi|17568701|ref|NP_510394.1| WD repeat domain 5B (43.1 kD) (XO96... 57 6e-07
gi|50421955|ref|XP_459538.1| unnamed protein product [Debaryomyc... 57 8e-07
gi|48891847|ref|ZP_00325296.1| COG2319: FOG: WD40 repeat [Tricho... 57 8e-07
gi|37520475|ref|NP_923852.1| WD-repeat protein [Gloeobacter viol... 56 1e-06
gi|45190866|ref|NP_985120.1| AER263Cp [Eremothecium gossypii] >g... 56 1e-06
gi|46410024|gb|AAS93869.1| G-protein beta subunit [Paramecium te... 56 1e-06
gi|45120096|ref|NP_694984.2| bromo domain-containing protein dis... 56 1e-06
gi|42766769|gb|AAS45472.1| bromodomain and WD repeat domain cont... 56 1e-06
gi|22450205|gb|AAM97148.1| sperm-associated WD repeat protein [M... 56 1e-06
gi|47218357|emb|CAG01878.1| unnamed protein product [Tetraodon n... 56 1e-06
gi|25404314|pir||A96638 hypothetical protein F11P17.7 [imported]... 56 1e-06
gi|12852956|dbj|BAB29591.1| unnamed protein product [Mus musculu... 56 1e-06
gi|32410627|ref|XP_325794.1| hypothetical protein [Neurospora cr... 56 1e-06
gi|49075508|ref|XP_401814.1| hypothetical protein UM04199.1 [Ust... 56 1e-06
gi|50582979|ref|NP_998605.1| pleiotropic regulator 1 [Danio reri... 56 1e-06
gi|37362268|gb|AAQ91262.1| pleiotropic regulator 1 [Danio rerio] 56 1e-06
gi|14031063|gb|AAK52092.1| WD-40 repeat protein [Lycopersicon es... 56 1e-06
gi|50728538|ref|XP_416167.1| PREDICTED: similar to Apoptotic pro... 55 2e-06
gi|49073067|ref|XP_400779.1| hypothetical protein UM03164.1 [Ust... 55 2e-06
gi|349828|gb|AAA02882.1| Miller-Dieker lissencephaly protein 55 2e-06
gi|17737533|ref|NP_523922.1| CG15010-PC [Drosophila melanogaster... 55 2e-06
gi|42562854|ref|NP_176316.3| WD-40 repeat family protein / katan... 55 2e-06
gi|46130696|ref|XP_389128.1| hypothetical protein FG08952.1 [Gib... 55 2e-06
gi|50308993|ref|XP_454502.1| unnamed protein product [Kluyveromy... 55 2e-06
gi|48893643|ref|ZP_00326841.1| COG2319: FOG: WD40 repeat [Tricho... 55 2e-06
gi|47551119|ref|NP_999734.1| katanin p80 subunit [Strongylocentr... 55 2e-06
gi|20302751|gb|AAM18877.1| unknown [Branchiostoma floridae] 55 2e-06
gi|41054770|ref|NP_957333.1| similar to WD repeat domain 1 [Dani... 55 2e-06
gi|37595360|gb|AAQ94566.1| WD repeat domain 1 [Danio rerio] >gnl... 55 2e-06
gi|38455441|gb|AAR20840.1| antigenic WD protein [Leishmania amaz... 55 2e-06
gi|24649265|ref|NP_651136.1| CG4448-PA [Drosophila melanogaster]... 55 2e-06
gi|50551875|ref|XP_503412.1| hypothetical protein [Yarrowia lipo... 55 2e-06
gi|19112019|ref|NP_595227.1| WD repeat protein [Schizosaccharomy... 55 2e-06
gi|49101231|ref|XP_410940.1| hypothetical protein AN6803.2 [Aspe... 55 2e-06
gi|23129787|ref|ZP_00111610.1| COG2319: FOG: WD40 repeat [Nostoc... 55 3e-06
gi|480009|pir||S36113 LIS-1 protein - human 55 3e-06
gi|13591874|ref|NP_112249.1| guanine nucleotide-binding protein,... 55 3e-06
gi|31231745|ref|XP_318586.1| ENSANGP00000020892 [Anopheles gambi... 55 3e-06
gi|7305363|ref|NP_038653.1| platelet-activating factor acetylhyd... 55 3e-06
gi|17056921|gb|AAL34972.1| Miller-Dieker lissencephaly protein [... 55 3e-06
gi|27807199|ref|NP_777088.1| platelet-activating factor acetylhy... 55 3e-06
gi|23574762|dbj|BAC20600.1| platelet activating factor acetylhyd... 55 3e-06
gi|4557741|ref|NP_000421.1| platelet-activating factor acetylhyd... 55 3e-06
gi|17534937|ref|NP_495299.1| Apg16L beta (2G742) [Caenorhabditis... 54 4e-06
gi|49119215|gb|AAH73215.1| Unknown (protein for MGC:80502) [Xeno... 54 4e-06
gi|48116262|ref|XP_393186.1| similar to CG6322-PA [Apis mellifera] 54 4e-06
gi|38089557|ref|XP_134311.2| katanin p80 (WD40-containing) subun... 54 4e-06
gi|15208165|dbj|BAB63107.1| hypothetical protein [Macaca fascicu... 54 4e-06
gi|6324012|ref|NP_014082.1| Polyadenylation Factor I subunit 2; ... 54 4e-06
gi|46433868|gb|EAK93295.1| hypothetical protein CaO19.6906 [Cand... 54 4e-06
gi|50797401|ref|XP_423947.1| PREDICTED: similar to nuclear recep... 54 4e-06
gi|12845754|dbj|BAB26884.1| unnamed protein product [Mus musculus] 54 4e-06
gi|37577053|gb|AAQ94086.1| guanine nucleotide binding protein be... 54 4e-06
gi|31240845|ref|XP_320836.1| ENSANGP00000017965 [Anopheles gambi... 54 4e-06
gi|31322517|gb|AAP20646.1| nuclear receptor co-repressor complex... 54 4e-06
gi|32410343|ref|XP_325652.1| hypothetical protein [Neurospora cr... 54 4e-06
gi|30584393|gb|AAP36445.1| Homo sapiens katanin p80 (WD40-contai... 54 4e-06
gi|34855547|ref|XP_345196.1| similar to nuclear receptor co-repr... 54 4e-06
gi|34555785|emb|CAA94873.2| Hypothetical protein K07C5.8 [Caenor... 54 4e-06
gi|17391209|gb|AAH18512.1| 8030499H02Rik protein [Mus musculus] 54 4e-06
gi|26331128|dbj|BAC29294.1| unnamed protein product [Mus musculus] 54 4e-06
gi|47498030|ref|NP_998874.1| hypothetical protein MGC69344 [Xeno... 54 4e-06
gi|12006108|gb|AAG44738.1| IRA1 [Mus musculus] 54 4e-06
gi|10434648|dbj|BAB14331.1| unnamed protein product [Homo sapiens] 54 4e-06
gi|31543001|ref|NP_109657.2| IRA1 protein [Mus musculus] >gnl|BL... 54 4e-06
gi|19913371|ref|NP_078941.2| nuclear receptor co-repressor/HDAC3... 54 4e-06
gi|12655011|gb|AAH01353.1| Katanin p80 subunit B 1 [Homo sapiens... 54 4e-06
gi|26329699|dbj|BAC28588.1| unnamed protein product [Mus musculu... 54 4e-06
gi|26327487|dbj|BAC27487.1| unnamed protein product [Mus musculus] 54 4e-06
gi|50554517|ref|XP_504667.1| hypothetical protein [Yarrowia lipo... 54 4e-06
gi|25406289|pir||D96764 unknown protein F25P22.14 [imported] - A... 54 5e-06
gi|14326447|gb|AAK60269.1| F-box protein FBX30 [Homo sapiens] 54 5e-06
gi|7023505|dbj|BAA91986.1| unnamed protein product [Homo sapiens] 54 5e-06
gi|2104937|gb|AAC63098.1| truncated form platelet-activating fac... 54 5e-06
gi|6323763|ref|NP_013834.1| WD repeat protein (G-beta like prote... 54 5e-06
gi|23127725|ref|ZP_00109588.1| COG2319: FOG: WD40 repeat [Nostoc... 54 5e-06
gi|16117779|ref|NP_060785.2| F-box protein FBW7 isoform 2; archi... 54 5e-06
gi|15220302|ref|NP_172582.1| WD-40 repeat family protein / katan... 54 5e-06
gi|112947|sp|P14197|AAC3_DICDI AAC-rich mRNA clone AAC3 protein ... 54 5e-06
gi|38089382|ref|XP_356101.1| similar to RIKEN cDNA 1500041N16 [M... 54 5e-06
gi|50746331|ref|XP_420447.1| PREDICTED: similar to F-box protein... 54 5e-06
gi|50423001|ref|XP_460079.1| unnamed protein product [Debaryomyc... 54 5e-06
gi|22330602|ref|NP_177513.2| transducin family protein / WD-40 r... 54 5e-06
gi|15822537|gb|AAG16640.1| F-box protein SEL10 [Homo sapiens] 54 5e-06
gi|38101677|gb|EAA48603.1| hypothetical protein MG00261.4 [Magna... 54 5e-06
gi|50428732|gb|AAT77083.1| putative WD G-beta repeat protein [Or... 54 5e-06
gi|47216288|emb|CAF96584.1| unnamed protein product [Tetraodon n... 54 5e-06
gi|19112135|ref|NP_595343.1| WD repeat protein [Schizosaccharomy... 54 5e-06
gi|42733793|gb|AAS38711.1| similar to Dictyostelium discoideum (... 54 5e-06
gi|16117781|ref|NP_361014.1| F-box protein FBW7 isoform 1; archi... 54 5e-06
gi|49523180|gb|AAH75588.1| Unknown (protein for MGC:89583) [Xeno... 54 5e-06
gi|4559414|gb|AAD23059.1| LIS [Mus musculus] 54 5e-06
gi|50414726|gb|AAH77273.1| Unknown (protein for IMAGE:4031030) [... 54 7e-06
gi|34394959|dbj|BAC84508.1| putative WD40 protein Ciao1 [Oryza s... 54 7e-06
gi|17974548|gb|AAL50052.1| F-box protein [Mus musculus] 54 7e-06
gi|21218434|ref|NP_536353.2| F-box and WD-40 domain protein 7, a... 54 7e-06
gi|7446138|pir||T02300 GTP-binding regulatory protein beta chain... 54 7e-06
gi|19113785|ref|NP_592873.1| WD repeat protein; related to tup1 ... 54 7e-06
gi|45524780|ref|ZP_00176045.1| COG2319: FOG: WD40 repeat [Crocos... 54 7e-06
gi|50256900|gb|EAL19618.1| hypothetical protein CNBG2460 [Crypto... 54 7e-06
gi|544373|sp|P36408|GBB_DICDI Guanine nucleotide-binding protein... 54 7e-06
gi|45198463|ref|NP_985492.1| AFL056Cp [Eremothecium gossypii] >g... 54 7e-06
gi|47523580|ref|NP_999415.1| platelet-activating factor acetylhy... 54 7e-06
gi|45383504|ref|NP_989655.1| platelet-activating factor acetylhy... 54 7e-06
gi|34783512|gb|AAH37320.1| FBXW7 protein [Homo sapiens] 54 7e-06
gi|12006104|gb|AAG44736.1| IRA1 [Homo sapiens] 54 7e-06
gi|2494899|sp|P56093|TUP1_CANAL Transcriptional repressor TUP1 >... 54 7e-06
gi|50553520|ref|XP_504171.1| hypothetical protein [Yarrowia lipo... 54 7e-06
gi|38111876|gb|EAA57376.1| hypothetical protein MG08345.4 [Magna... 54 7e-06
gi|13472512|ref|NP_104079.1| WD-repeart protein, beta transducin... 54 7e-06
gi|46442451|gb|EAL01740.1| hypothetical protein CaO19.4268 [Cand... 53 9e-06
gi|6325435|ref|NP_015504.1| Splicing factor, component of the U4... 53 9e-06
gi|22298032|ref|NP_681279.1| WD-40 repeat protein [Thermosynecho... 53 9e-06
gi|13991907|gb|AAK51552.1| receptor for activated protein kinase... 53 9e-06
gi|48854377|ref|ZP_00308540.1| COG2319: FOG: WD40 repeat [Cytoph... 53 9e-06
gi|31980791|ref|NP_058064.2| pleiotropic regulator 1 [Mus muscul... 53 9e-06
gi|50746132|ref|XP_420368.1| PREDICTED: similar to Pleiotropic r... 53 9e-06
gi|2832298|gb|AAC04388.1| pleiotropic regulator 1 [Mus musculus] 53 9e-06
gi|28273371|gb|AAO38457.1| lethal(2)denticleless-like protein [O... 53 9e-06
gi|5031817|ref|NP_005877.1| katanin p80 subunit B 1; katanin (80... 53 9e-06
gi|4505895|ref|NP_002660.1| pleiotropic regulator 1 (PRL1homolog... 53 9e-06
gi|11120706|ref|NP_068525.1| pleiotropic regulator 1 [Rattus nor... 53 9e-06
gi|15242311|ref|NP_196473.1| transducin family protein / WD-40 r... 53 9e-06
gi|3983133|gb|AAC83819.1| pf20 homolog [Trypanosoma brucei] 53 9e-06
gi|41054115|ref|NP_956146.1| Unknown (protein for MGC:63765); wu... 53 9e-06
gi|49098036|ref|XP_410478.1| hypothetical protein AN6341.2 [Aspe... 53 9e-06
gi|49115497|gb|AAH73405.1| Unknown (protein for MGC:80868) [Xeno... 53 9e-06
gi|4028547|gb|AAC97114.1| MEK kinase alpha [Dictyostelium discoi... 53 9e-06
gi|18088489|gb|AAH20786.1| PLRG1 protein [Homo sapiens] 53 9e-06
gi|1491718|emb|CAA64777.1| hTAFII100 [Homo sapiens] 53 1e-05
gi|19113239|ref|NP_596447.1| wd-repeat protein pop1. [Schizosacc... 53 1e-05
gi|34863779|ref|XP_219965.2| similar to RIKEN cDNA 6330528C20 ge... 53 1e-05
gi|18415801|ref|NP_568194.1| transducin family protein / WD-40 r... 53 1e-05
gi|17137196|ref|NP_477160.1| CG8440-PA [Drosophila melanogaster]... 53 1e-05
gi|3983137|gb|AAC83821.1| Lis1 homolog [Drosophila melanogaster] 53 1e-05
gi|30354079|gb|AAH52268.1| TAF5 protein [Homo sapiens] 53 1e-05
>gi|25143635|ref|NP_490988.2| eukaryotic Initiation Factor (36.9 kD)
(eif-3.I) [Caenorhabditis elegans]
gi|18652640|gb|AAK68601.2| Eukaryotic initiation factor protein 3.I
[Caenorhabditis elegans]
Length = 327
Score = 681 bits (1757), Expect = 0.0
Identities = 327/327 (100%), Positives = 327/327 (100%)
Frame = +1
Query: 1 MRPLSLKGHERALTRVRFNREGDLTFSCAKDKKPCVWYTENGERIGSYDGHNGAVWDIDV 180
MRPLSLKGHERALTRVRFNREGDLTFSCAKDKKPCVWYTENGERIGSYDGHNGAVWDIDV
Sbjct: 1 MRPLSLKGHERALTRVRFNREGDLTFSCAKDKKPCVWYTENGERIGSYDGHNGAVWDIDV 60
Query: 181 SWDTTKCVTASGDLTVKIWDAELGNCLYTINHQTPMKSCGFSYSGNLVCFTTQKMTKNLS 360
SWDTTKCVTASGDLTVKIWDAELGNCLYTINHQTPMKSCGFSYSGNLVCFTTQKMTKNLS
Sbjct: 61 SWDTTKCVTASGDLTVKIWDAELGNCLYTINHQTPMKSCGFSYSGNLVCFTTQKMTKNLS 120
Query: 361 TFQVRDLRDSSQMVEGGESFFYSQFDVNATTALFTQMDDLVTIGFESGLLQQYDLRNPDT 540
TFQVRDLRDSSQMVEGGESFFYSQFDVNATTALFTQMDDLVTIGFESGLLQQYDLRNPDT
Sbjct: 121 TFQVRDLRDSSQMVEGGESFFYSQFDVNATTALFTQMDDLVTIGFESGLLQQYDLRNPDT 180
Query: 541 PIHTNESVHRYSVQDLQLSPRGDFLISASRDKTAALLDVNDLKKLKQYKSERPVNSACIS 720
PIHTNESVHRYSVQDLQLSPRGDFLISASRDKTAALLDVNDLKKLKQYKSERPVNSACIS
Sbjct: 181 PIHTNESVHRYSVQDLQLSPRGDFLISASRDKTAALLDVNDLKKLKQYKSERPVNSACIS 240
Query: 721 PNRDHICLGGGEDAMQVTQTSVSAGHFEAKIYHMVFEEEFARFKGHFGPINTMAWHPSGT 900
PNRDHICLGGGEDAMQVTQTSVSAGHFEAKIYHMVFEEEFARFKGHFGPINTMAWHPSGT
Sbjct: 241 PNRDHICLGGGEDAMQVTQTSVSAGHFEAKIYHMVFEEEFARFKGHFGPINTMAWHPSGT 300
Query: 901 IIATGGEDGYIRIQEFDEDYLGFTYDF 981
IIATGGEDGYIRIQEFDEDYLGFTYDF
Sbjct: 301 IIATGGEDGYIRIQEFDEDYLGFTYDF 327
>gi|39595353|emb|CAE60390.1| Hypothetical protein CBG03991
[Caenorhabditis briggsae]
Length = 327
Score = 648 bits (1671), Expect = 0.0
Identities = 305/327 (93%), Positives = 321/327 (97%)
Frame = +1
Query: 1 MRPLSLKGHERALTRVRFNREGDLTFSCAKDKKPCVWYTENGERIGSYDGHNGAVWDIDV 180
MRPLSLKGHERALTRVRFNREGDLTFSCAKDKKPCVWYTENGERIGSYDGHNGAVWDIDV
Sbjct: 1 MRPLSLKGHERALTRVRFNREGDLTFSCAKDKKPCVWYTENGERIGSYDGHNGAVWDIDV 60
Query: 181 SWDTTKCVTASGDLTVKIWDAELGNCLYTINHQTPMKSCGFSYSGNLVCFTTQKMTKNLS 360
SWDT+KCVTASGDLTVKIWDAELG+C+YTINHQTPMKSCGFSYSGNLVC+TTQKMTKNLS
Sbjct: 61 SWDTSKCVTASGDLTVKIWDAELGSCIYTINHQTPMKSCGFSYSGNLVCYTTQKMTKNLS 120
Query: 361 TFQVRDLRDSSQMVEGGESFFYSQFDVNATTALFTQMDDLVTIGFESGLLQQYDLRNPDT 540
T QVRDLRD +QM EG ESFF +QFDVNATTALF+QMDD++TIGFESGLLQQYDLRNPD+
Sbjct: 121 TVQVRDLRDGNQMAEGAESFFSTQFDVNATTALFSQMDDIITIGFESGLLQQYDLRNPDS 180
Query: 541 PIHTNESVHRYSVQDLQLSPRGDFLISASRDKTAALLDVNDLKKLKQYKSERPVNSACIS 720
PI+TNE VHRYS+QDLQLSPRGDFLISASRDKTAALLDVNDLKKLKQYKSERPVNSACI+
Sbjct: 181 PINTNEVVHRYSIQDLQLSPRGDFLISASRDKTAALLDVNDLKKLKQYKSERPVNSACIA 240
Query: 721 PNRDHICLGGGEDAMQVTQTSVSAGHFEAKIYHMVFEEEFARFKGHFGPINTMAWHPSGT 900
PNRDHICLGGGEDAMQVTQT+VSAGHFEAKIYHMVFEEEFARFKGHFGPINTMAWHPSG+
Sbjct: 241 PNRDHICLGGGEDAMQVTQTAVSAGHFEAKIYHMVFEEEFARFKGHFGPINTMAWHPSGS 300
Query: 901 IIATGGEDGYIRIQEFDEDYLGFTYDF 981
IIATGGEDGY+RIQEFDEDYLGFTYDF
Sbjct: 301 IIATGGEDGYVRIQEFDEDYLGFTYDF 327