Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y74C9A_1
(705 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17510631|ref|NP_490660.1| AD-003 protein (26.6 kD) (1A478) [C... 486 e-136
gi|39595288|emb|CAE60325.1| Hypothetical protein CBG03917 [Caeno... 403 e-111
gi|39594796|emb|CAE70664.1| Hypothetical protein CBG17371 [Caeno... 256 3e-67
gi|47086239|ref|NP_998063.1| hypothetical protein zgc:77488 [Dan... 172 8e-42
gi|47214518|emb|CAF96711.1| unnamed protein product [Tetraodon n... 169 5e-41
gi|24528555|ref|NP_733480.1| RIKEN cDNA 2610205E22 [Mus musculus... 167 1e-40
gi|12655091|gb|AAH01396.1| AD-003 protein [Homo sapiens] >gnl|BL... 165 7e-40
gi|24652235|ref|NP_610528.1| CG1675-PA [Drosophila melanogaster]... 162 6e-39
gi|7661528|ref|NP_054783.1| AD-003 protein [Homo sapiens] >gnl|B... 161 1e-38
gi|50290433|ref|XP_447648.1| unnamed protein product [Candida gl... 160 2e-38
gi|6523567|emb|CAB62288.1| hypothetical protein [Zygosaccharomyc... 160 2e-38
gi|45199133|ref|NP_986162.1| AFR615Wp [Eremothecium gossypii] >g... 151 1e-35
gi|6319738|ref|NP_009820.1| Putative S-adenosylmethionine-depend... 150 2e-35
gi|19115139|ref|NP_594227.1| Putative S-adenosylmethionine-depen... 149 4e-35
gi|38073549|ref|XP_136356.3| similar to RIKEN cDNA 2610205E22 [M... 147 3e-34
gi|50310311|ref|XP_455175.1| unnamed protein product [Kluyveromy... 144 2e-33
gi|50542916|ref|XP_499624.1| hypothetical protein [Yarrowia lipo... 144 2e-33
gi|42568315|ref|NP_199258.2| expressed protein [Arabidopsis thal... 143 3e-33
gi|47212455|emb|CAF94107.1| unnamed protein product [Tetraodon n... 140 3e-32
gi|50751087|ref|XP_426622.1| PREDICTED: similar to RIKEN cDNA 26... 139 4e-32
gi|34897080|ref|NP_909886.1| unknown protein [Oryza sativa (japo... 139 6e-32
gi|38105958|gb|EAA52322.1| hypothetical protein MG05014.4 [Magna... 137 2e-31
gi|46442225|gb|EAL01516.1| hypothetical protein CaO19.7069 [Cand... 128 1e-28
gi|46111079|ref|XP_382597.1| hypothetical protein FG02421.1 [Gib... 124 2e-27
gi|50405867|ref|XP_456574.1| unnamed protein product [Debaryomyc... 122 5e-27
gi|32412254|ref|XP_326607.1| hypothetical protein ( hypothetical... 122 5e-27
gi|37548667|ref|XP_089281.2| similar to AD-003 protein [Homo sap... 119 6e-26
gi|50777597|ref|XP_423291.1| PREDICTED: similar to RIKEN cDNA 26... 117 2e-25
gi|34880878|ref|XP_222824.2| similar to RIKEN cDNA 2610205E22 [R... 108 1e-22
gi|9758698|dbj|BAB09152.1| unnamed protein product [Arabidopsis ... 105 1e-21
gi|32398708|emb|CAD98668.1| conserved hypothetical protein [Cryp... 102 8e-21
gi|34853498|ref|XP_342407.1| similar to RIKEN cDNA 2610205E22 [R... 85 2e-15
gi|29247663|gb|EAA39218.1| GLP_239_20469_21263 [Giardia lamblia ... 82 8e-15
gi|49070288|ref|XP_399433.1| hypothetical protein UM01818.1 [Ust... 82 8e-15
gi|50254668|gb|EAL17415.1| hypothetical protein CNBM2190 [Crypto... 69 9e-11
gi|47225231|emb|CAG09731.1| unnamed protein product [Tetraodon n... 50 3e-05
gi|28436074|dbj|BAC57432.1| phosphoethanolamine N-methyltransfer... 45 0.001
gi|296559|emb|CAA49925.1| unnamed protein product [Saccharomyces... 45 0.001
gi|48893217|ref|ZP_00326486.1| COG3914: Predicted O-linked N-ace... 45 0.002
gi|28828631|gb|AAO51234.1| hypothetical protein [Dictyostelium d... 44 0.004
gi|45272584|gb|AAS57723.1| phosphoethanolamine N-methyltransfera... 43 0.005
gi|34911440|ref|NP_917067.1| putative phosphoethanolamine methyl... 43 0.005
gi|24212082|sp|Q9M571|PEAM_SPIOL Phosphoethanolamine N-methyltra... 43 0.005
gi|50417800|gb|AAH78119.1| Unknown (protein for MGC:83638) [Xeno... 42 0.009
gi|16331517|ref|NP_442245.1| unknown protein [Synechocystis sp. ... 42 0.012
gi|42572097|ref|NP_974139.1| phosphoethanolamine N-methyltransfe... 42 0.016
gi|24212080|sp|Q9C6B9|PEM3_ARATH Putative phosphoethanolamine N-... 42 0.016
gi|15219502|ref|NP_177501.1| phosphoethanolamine N-methyltransfe... 42 0.016
gi|47900487|gb|AAT39244.1| putative phosphoethanolamine N-methyl... 41 0.027
gi|23619361|ref|NP_705323.1| phosphoethanolamine N-methyltransfe... 40 0.035
gi|39596848|emb|CAE59075.1| Hypothetical protein CBG02363 [Caeno... 40 0.035
gi|28804509|dbj|BAC57960.1| phosphoethanolamine N-methyltransfer... 40 0.046
gi|13541727|ref|NP_111415.1| Predicted SAM-dependent methyltrans... 40 0.060
gi|21228735|ref|NP_634657.1| hypothetical protein MM2633 [Methan... 40 0.060
gi|24372987|ref|NP_717029.1| conserved hypothetical protein [She... 39 0.079
gi|15895638|ref|NP_348987.1| S-adenosylmethionine-dependent meth... 39 0.079
gi|37777776|gb|AAR02419.1| flavonoid 4'-O-methyltransferase [Cat... 39 0.079
gi|17537905|ref|NP_494991.1| putative protein family member of a... 39 0.10
gi|7511249|pir||T27936 hypothetical protein ZK622.3 - Caenorhabd... 39 0.10
gi|32564740|ref|NP_494990.2| putative cytoplasmic protein family... 39 0.10
gi|32564744|ref|NP_871998.1| putative cytoplasmic protein family... 39 0.10
gi|17887465|gb|AAL40895.1| phosphoethanolamine methyltransferase... 39 0.13
gi|15223977|ref|NP_177877.1| O-methyltransferase family 2 protei... 39 0.13
gi|26891692|gb|AAM97497.1| flavonoid O-methyltransferase [Cathar... 39 0.13
gi|530214|gb|AAB16938.1| carminomycin 4-O-methyltransferase 38 0.18
gi|21618183|gb|AAM67233.1| caffeic acid 3-O-methyltransferase-li... 37 0.30
gi|15238847|ref|NP_200192.1| O-methyltransferase, putative [Arab... 37 0.30
gi|45548056|ref|ZP_00188092.1| COG0500: SAM-dependent methyltran... 37 0.30
gi|2282586|gb|AAB71213.1| methyltransferase [Prunus armeniaca] 37 0.39
gi|15223976|ref|NP_177876.1| O-methyltransferase family 2 protei... 37 0.39
gi|27808586|gb|AAO24573.1| At1g77520 [Arabidopsis thaliana] 37 0.39
gi|15838750|ref|NP_299438.1| hypothetical protein XF2159 [Xylell... 37 0.39
gi|12584943|gb|AAG59894.1| phosphoethanolamine N-methyltransfera... 37 0.39
gi|23129879|ref|ZP_00111702.1| COG0500: SAM-dependent methyltran... 37 0.39
gi|729153|sp|Q06528|CM4T_STRPE Carminomycin 4-O-methyltransferas... 37 0.39
gi|18309532|ref|NP_561466.1| spermidine synthase [Clostridium pe... 37 0.39
gi|21593350|gb|AAM65299.1| putative caffeic acid 3-O-methyltrans... 37 0.39
gi|8778696|gb|AAF79704.1| T1N15.22 [Arabidopsis thaliana] 37 0.51
gi|42571805|ref|NP_973993.1| phosphoethanolamine N-methyltransfe... 37 0.51
gi|15221909|ref|NP_175293.1| phosphoethanolamine N-methyltransfe... 37 0.51
gi|38105830|gb|EAA52209.1| hypothetical protein MG04901.4 [Magna... 37 0.51
gi|48836922|ref|ZP_00293917.1| COG0500: SAM-dependent methyltran... 37 0.51
gi|29828914|ref|NP_823548.1| putative methyltransferase [Strepto... 37 0.51
gi|38047399|gb|AAR09602.1| flavonoid 4'-O-methyltransferase [Men... 36 0.67
gi|7447883|pir||T09600 catechol O-methyltransferase homolog - Mo... 36 0.67
gi|1777386|gb|AAC49708.1| caffeic acid O-methyltransferase 36 0.67
gi|38047401|gb|AAR09603.1| O-methyltransferase [Mentha x piperita] 36 0.67
gi|4574324|gb|AAD24001.1| caffeic acid ortho-methyltransferase [... 36 0.87
gi|46118235|ref|ZP_00174848.2| COG0500: SAM-dependent methyltran... 36 0.87
gi|27375325|ref|NP_766854.1| 3-demethylubiquinone-9 3-methyltran... 36 0.87
gi|48057593|gb|AAT39937.1| putative methyltransferase [Solanum d... 36 0.87
gi|29839344|sp|Q8GU25|COMT_ROSCH Caffeic acid 3-O-methyltransfer... 35 1.1
gi|32440933|dbj|BAC78827.1| caffeic acid O-methyltransferase [Ro... 35 1.1
gi|20090585|ref|NP_616660.1| conserved hypothetical protein [Met... 35 1.1
gi|3913295|sp|Q43609|COMT_PRUDU Caffeic acid 3-O-methyltransfera... 35 1.5
gi|23123675|ref|ZP_00105736.1| COG4106: Trans-aconitate methyltr... 35 1.5
gi|40882246|emb|CAF06071.1| conserved hypothetical protein [Neur... 35 1.5
gi|27381611|ref|NP_773140.1| bll6500 [Bradyrhizobium japonicum U... 35 1.5
gi|23130477|ref|ZP_00112292.1| COG0500: SAM-dependent methyltran... 35 1.5
gi|47824983|gb|AAT38756.1| putative methyltransferase [Solanum d... 35 1.5
gi|32406234|ref|XP_323730.1| hypothetical protein [Neurospora cr... 35 1.5
gi|32034029|ref|ZP_00134273.1| COG0500: SAM-dependent methyltran... 35 1.9
gi|38102150|gb|EAA49023.1| hypothetical protein MG00681.4 [Magna... 35 1.9
gi|47824906|gb|AAT38682.1| putative methyltransferase, 3'-partia... 35 1.9
gi|47825032|gb|AAT38802.1| putative methyltransferase family pro... 35 1.9
gi|16126144|ref|NP_420708.1| conserved hypothetical protein [Cau... 35 1.9
gi|6760443|gb|AAF28353.1| O-methyltransferase [Fragaria x ananassa] 34 2.5
gi|39591353|emb|CAE73406.1| Hypothetical protein CBG20848 [Caeno... 34 2.5
gi|16329222|ref|NP_439950.1| unknown protein [Synechocystis sp. ... 34 2.5
gi|48833423|ref|ZP_00290442.1| COG2227: 2-polyprenyl-3-methyl-5-... 34 2.5
gi|50422103|ref|XP_459613.1| unnamed protein product [Debaryomyc... 34 2.5
gi|2781394|gb|AAB96879.1| O-methyltransferase 1 [Arabidopsis tha... 34 2.5
gi|15239571|ref|NP_200227.1| quercetin 3-O-methyltransferase 1 /... 34 2.5
gi|29839421|sp|Q9XGW0|COM1_OCIBA Caffeic acid 3-O-methyltransfer... 34 2.5
gi|27369804|ref|NP_766155.1| methyltransferase like 2 [Mus muscu... 34 3.3
gi|46575943|gb|AAT01304.1| putative o-methyltransferase ZRP4 [Or... 34 3.3
gi|46138453|ref|XP_390917.1| hypothetical protein FG10741.1 [Gib... 34 3.3
gi|20090112|ref|NP_616187.1| ubiE/COQ5 methyltransferase [Methan... 34 3.3
gi|42523796|ref|NP_969176.1| Ubiquinone/menaquinone biosynthesis... 34 3.3
gi|33943786|gb|AAQ55554.1| MPBQ/MSBQ transferase cyanobacterial ... 34 3.3
gi|37680383|ref|NP_934992.1| tellurite resistance protein-relate... 34 3.3
gi|15231756|ref|NP_190882.1| O-diphenol-O-methyl transferase, pu... 34 3.3
gi|9294501|dbj|BAB02720.1| methyl transferase-like protein [Arab... 33 4.3
gi|38565551|gb|AAR24097.1| caffeic acid O-methyltransferase [Amm... 33 4.3
gi|28829776|gb|AAO52278.1| hypothetical protein [Dictyostelium d... 33 4.3
gi|32478660|gb|AAP83582.1| phosphoethanolamine N-methyltransfera... 33 4.3
gi|50086367|ref|YP_047877.1| conserved hypothetical protein; put... 33 4.3
gi|15807020|ref|NP_295748.1| ArgE/DapE/Acy1 family protein [Dein... 33 4.3
gi|24987368|pdb|1IY9|A Chain A, Crystal Structure Of Spermidine ... 33 4.3
gi|16080802|ref|NP_391630.1| spermidine synthase [Bacillus subti... 33 4.3
gi|29839420|sp|Q9XGV9|COM2_OCIBA Caffeic acid 3-O-methyltransfer... 33 4.3
gi|28199106|ref|NP_779420.1| conserved hypothetical protein [Xyl... 33 5.6
gi|2130032|pir||S52015 catechol O-methyltransferase (EC 2.1.1.6)... 33 5.6
gi|6320672|ref|NP_010752.1| appears to control expression of spl... 33 5.6
gi|40787745|gb|AAH64929.1| METTL2 protein [Homo sapiens] 33 5.6
gi|28194657|gb|AAO33590.1| putative caffeic acid methyl transfer... 33 5.6
gi|30684743|ref|NP_188427.2| phosphoethanolamine N-methyltransfe... 33 5.6
gi|20260388|gb|AAM13092.1| unknown protein [Arabidopsis thaliana] 33 5.6
gi|730779|sp|P38904|SP41_YEAST SPP41 protein >gnl|BL_ORD_ID|5656... 33 5.6
gi|32265573|ref|NP_859605.1| conserved hypothetical protein [Hel... 33 5.6
gi|21674029|ref|NP_662094.1| conserved hypothetical protein [Chl... 33 5.6
gi|19527376|ref|NP_598902.1| RIKEN cDNA 2810413N20 [Mus musculus... 33 5.6
gi|46575944|gb|AAT01305.1| putative o-methyltransferase ZRP4 [Or... 33 5.6
gi|8923005|ref|NP_060866.1| methyltransferase like 2 [Homo sapie... 33 5.6
gi|27365518|ref|NP_761046.1| Tellurite resistance protein-relate... 33 5.6
gi|17230530|ref|NP_487078.1| hypothetical protein [Nostoc sp. PC... 33 5.6
gi|29244966|gb|EAA36637.1| GLP_279_6181_4310 [Giardia lamblia AT... 33 7.4
gi|3252825|gb|AAC24311.1| Unknown gene product [Homo sapiens] >g... 33 7.4
gi|46360130|gb|AAS88888.1| AAMYI [Ostreococcus tauri] 33 7.4
gi|50756149|ref|XP_415038.1| PREDICTED: similar to chromosome 20... 33 7.4
gi|48105697|ref|XP_395984.1| similar to CG8067-PA [Apis mellifera] 33 7.4
gi|34498739|ref|NP_902954.1| conserved hypothetical protein [Chr... 33 7.4
gi|13937773|gb|AAH06985.1| FLJ12760 protein [Homo sapiens] 32 9.6
gi|32401416|ref|NP_859076.1| hypothetical protein FLJ12760 [Homo... 32 9.6
gi|37537982|sp|Q96IZ6|MTL2_HUMAN Methyltransferase-like protein ... 32 9.6
gi|17566488|ref|NP_507910.1| CDK5 regulatory associated protein ... 32 9.6
>gi|17510631|ref|NP_490660.1| AD-003 protein (26.6 kD) (1A478)
[Caenorhabditis elegans]
gi|14550391|gb|AAF36050.2| Hypothetical protein Y74C9A.3
[Caenorhabditis elegans]
Length = 234
Score = 486 bits (1251), Expect = e-136
Identities = 234/234 (100%), Positives = 234/234 (100%)
Frame = -1
Query: 705 MSSSSSSRIHNGEDVYEKAEEYWSRASQDVNGMLGGFEALHAPDISASKRFIEGLKKKNL 526
MSSSSSSRIHNGEDVYEKAEEYWSRASQDVNGMLGGFEALHAPDISASKRFIEGLKKKNL
Sbjct: 1 MSSSSSSRIHNGEDVYEKAEEYWSRASQDVNGMLGGFEALHAPDISASKRFIEGLKKKNL 60
Query: 525 FGYFDYALDCGAGIGRVTKHLLMPFFSKVDMEDVVEELITKSDQYIGKHPRIGDKFVEGL 346
FGYFDYALDCGAGIGRVTKHLLMPFFSKVDMEDVVEELITKSDQYIGKHPRIGDKFVEGL
Sbjct: 61 FGYFDYALDCGAGIGRVTKHLLMPFFSKVDMEDVVEELITKSDQYIGKHPRIGDKFVEGL 120
Query: 345 QTFAPPERRYDLIWIQWVSGHLVDEDLVDFFKRCAKGLKPGGCIVLKDNVTNHEKRLFDD 166
QTFAPPERRYDLIWIQWVSGHLVDEDLVDFFKRCAKGLKPGGCIVLKDNVTNHEKRLFDD
Sbjct: 121 QTFAPPERRYDLIWIQWVSGHLVDEDLVDFFKRCAKGLKPGGCIVLKDNVTNHEKRLFDD 180
Query: 165 DDHSWTRTEPELLKAFADSQLDMVSKALQTGFPKEIYPVKMYALKPQHTGFTNN 4
DDHSWTRTEPELLKAFADSQLDMVSKALQTGFPKEIYPVKMYALKPQHTGFTNN
Sbjct: 181 DDHSWTRTEPELLKAFADSQLDMVSKALQTGFPKEIYPVKMYALKPQHTGFTNN 234