Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y74C9A_2
         (372 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17510629|ref|NP_490661.1| putative protein, with a coiled coi...   237   4e-62
gi|39595287|emb|CAE60324.1| Hypothetical protein CBG03916 [Caeno...   205   2e-52
gi|13162326|ref|NP_077057.1| bile acid CoA ligase [Rattus norveg...    34   0.60
gi|493598|gb|AAA89204.1| major immediate early protein                 33   1.0
gi|3335571|gb|AAC40189.1| fatty acid transport protein 5; FATP5 ...    33   1.0
gi|6678011|ref|NP_033538.1| solute carrier family 27 (fatty acid...    33   1.0
gi|15342010|gb|AAH13272.1| Solute carrier family 27 (fatty acid ...    33   1.0
gi|7430421|pir||JW0107 very-long-chain acyl-CoA synthetase relat...    33   1.0
gi|25370634|pir||A84904 hypothetical protein At2g46530 [imported...    33   1.3
gi|46442434|gb|EAL01723.1| hypothetical protein CaO19.4251 [Cand...    33   1.3
gi|42569975|ref|NP_182176.2| transcriptional factor B3 family pr...    33   1.3
gi|46363042|ref|ZP_00225835.1| COG0749: DNA polymerase I - 3'-5'...    33   1.8
gi|33319614|gb|AAQ05710.1| Ig heavy chain variable region, VH3 f...    33   1.8
gi|39582124|emb|CAE60801.1| Hypothetical protein CBG04493 [Caeno...    32   2.3
gi|37530554|ref|NP_919579.1| putative non-LTR retroelement rever...    32   2.3
gi|17569509|ref|NP_509768.1| SYnapse Defective SYD-2, liprin-alp...    32   3.0
gi|18855044|gb|AAL79736.1| putative transcription factor [Oryza ...    32   3.0
gi|46253794|gb|AAS85869.1| immunoglobulin heavy chain [Homo sapi...    32   3.0
gi|46442568|gb|EAL01856.1| hypothetical protein CaO19.11726 [Can...    32   3.9
gi|17556268|ref|NP_499557.1| putative nuclear protein, with 6 co...    32   3.9
gi|19075919|ref|NP_588419.1| putative protein phosphatase regula...    32   3.9
gi|48846513|ref|ZP_00300775.1| COG0501: Zn-dependent protease wi...    32   3.9
gi|4454550|gb|AAD20945.1| silencing mediator of retinoic acid an...    31   5.1
gi|15890024|ref|NP_355705.1| AGR_C_5036p [Agrobacterium tumefaci...    31   5.1
gi|17936650|ref|NP_533440.1| conserved hypothetical protein [Agr...    31   5.1
gi|4454548|gb|AAD20944.1| silencing mediator of retinoic acid an...    31   5.1
gi|41409318|ref|NP_962154.1| hypothetical protein MAP3220c [Myco...    31   5.1
gi|12643930|sp|Q9WU42|NCR2_MOUSE Nuclear receptor corepressor 2 ...    31   5.1
gi|87818|pir||C34964 Ig heavy chain precursor V-III region (Ab21...    31   5.1
gi|6754804|ref|NP_035554.1| nuclear receptor co-repressor 2; sil...    31   5.1
gi|17148989|gb|AAL35869.1| immunoglobulin heavy chain variable d...    31   5.1
gi|668327|gb|AAA62276.1| chimeric immunoglobulin-L-asparaginase ...    31   5.1
gi|34935553|ref|XP_234603.2| similar to immunoglobulin heavy cha...    31   6.7
gi|14670268|ref|NP_002895.3| RD RNA-binding protein; major histo...    31   6.7
gi|48861729|ref|ZP_00315629.1| COG4232: Thiol:disulfide intercha...    31   6.7
gi|42564975|ref|NP_188410.2| DNAJ heat shock family protein [Ara...    31   6.7
gi|386949|gb|AAA36308.1| MHC HLA-RD protein                            31   6.7
gi|33945219|emb|CAE12024.1| putative transposase, IS21 family [M...    31   6.7
gi|27497197|gb|AAN64226.1| Orf22 [Photorhabdus luminescens]            31   6.7
gi|38087900|ref|XP_356418.1| similar to RIKEN cDNA 3830403N18 [M...    31   6.7
gi|15079544|gb|AAH11600.1| Similar to RD RNA-binding protein [Ho...    31   6.7
gi|50551375|ref|XP_503161.1| hypothetical protein [Yarrowia lipo...    31   6.7
gi|50418259|gb|AAH77838.1| Unknown (protein for MGC:80525) [Xeno...    31   6.7
gi|4506967|ref|NP_003027.1| v-ski sarcoma viral oncogene homolog...    31   6.7
gi|34529838|dbj|BAC85781.1| unnamed protein product [Homo sapiens]     30   8.7
gi|24762816|ref|NP_523860.2| CG15792-PA [Drosophila melanogaster...    30   8.7
gi|1572481|gb|AAB09049.1| nonmuscle myosin-II heavy chain [Droso...    30   8.7
gi|2119295|pir||S61477 myosin II heavy chain, non-muscle - fruit...    30   8.7
gi|46140537|ref|ZP_00203653.1| COG1139: Uncharacterized conserve...    30   8.7
gi|547969|sp|Q99323|MYSN_DROME Myosin heavy chain, non-muscle (Z...    30   8.7
gi|49670698|gb|AAH75509.1| Unknown (protein for IMAGE:6989250) [...    30   8.7
gi|1572480|gb|AAB09048.1| nonmuscle myosin-II heavy chain [Droso...    30   8.7
gi|41147250|ref|XP_373107.1| similar to cAMP-regulated phosphopr...    30   8.7
gi|48976054|ref|NP_079104.2| chromosome 9 open reading frame 82 ...    30   8.7
gi|10435735|dbj|BAB14655.1| unnamed protein product [Homo sapiens]     30   8.7
gi|15779196|gb|AAH14658.1| Chromosome 9 open reading frame 82 [H...    30   8.7
gi|7671651|emb|CAB89308.1| dJ34F7.8 (RD (RDBP)) [Homo sapiens]         30   8.7
gi|24762818|ref|NP_726506.1| CG15792-PB [Drosophila melanogaster...    30   8.7
gi|1572482|gb|AAB09050.1| nonmuscle myosin-II heavy chain [Droso...    30   8.7
gi|1141790|gb|AAB09051.1| nonmuscle myosin-II heavy chain [Droso...    30   8.7
gi|157953|gb|AAA28713.1| non-muscle myosin heavy chain                 30   8.7
gi|39585865|emb|CAE61279.1| Hypothetical protein CBG05098 [Caeno...    30   8.7
gi|45201006|ref|NP_986576.1| AGL090Wp [Eremothecium gossypii] >g...    30   8.7


>gi|17510629|ref|NP_490661.1| putative protein, with a coiled coil-4
           domain (13.7 kD) (1A489) [Caenorhabditis elegans]
 gi|7105658|gb|AAF36049.1| Hypothetical protein Y74C9A.2
           [Caenorhabditis elegans]
          Length = 123

 Score =  237 bits (605), Expect = 4e-62
 Identities = 123/123 (100%), Positives = 123/123 (100%)
 Frame = +1

Query: 1   MKLVILLSFVATVAVFAAPSAPAGLEEKLRALQEQLYSLEKENGVDVKQKEQPAAADTFL 180
           MKLVILLSFVATVAVFAAPSAPAGLEEKLRALQEQLYSLEKENGVDVKQKEQPAAADTFL
Sbjct: 1   MKLVILLSFVATVAVFAAPSAPAGLEEKLRALQEQLYSLEKENGVDVKQKEQPAAADTFL 60

Query: 181 GFVPQKRMVAWQPMKRSMINEDSRAPLLHAIEARLAEVLRAGERLGVNPEEVLADLRARN 360
           GFVPQKRMVAWQPMKRSMINEDSRAPLLHAIEARLAEVLRAGERLGVNPEEVLADLRARN
Sbjct: 61  GFVPQKRMVAWQPMKRSMINEDSRAPLLHAIEARLAEVLRAGERLGVNPEEVLADLRARN 120

Query: 361 QFQ 369
           QFQ
Sbjct: 121 QFQ 123




[DB home][top]