Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y77E11A_13
         (891 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ...   221   2e-56
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno...   189   7e-47
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]            102   1e-20
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...    79   1e-13
gi|687634|gb|AAA62504.1| collagen                                      77   5e-13
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...    70   6e-11
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno...    69   1e-10
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel...    62   2e-08
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ...    62   2e-08
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno...    61   3e-08
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno...    60   8e-08
gi|48763005|ref|ZP_00267562.1| hypothetical protein Rrub02003719...    59   1e-07
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno...    57   4e-07
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ...    57   5e-07
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ...    57   5e-07
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno...    56   9e-07
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-...    56   1e-06
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    55   2e-06
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ...    55   3e-06
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel...    54   5e-06
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1                   54   5e-06
gi|28377133|ref|NP_784025.1| cell surface protein precursor [Lac...    54   5e-06
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ...    54   5e-06
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    54   5e-06
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre...    54   6e-06
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno...    53   8e-06
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ...    53   8e-06
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno...    53   1e-05
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno...    53   1e-05
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi...    53   1e-05
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand...    52   2e-05
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand...    52   2e-05
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec...    52   2e-05
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ...    52   2e-05
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ...    52   2e-05
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [...    51   3e-05
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ...    51   3e-05
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno...    51   4e-05
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8]                  51   4e-05
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ...    51   4e-05
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv...    51   4e-05
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno...    51   4e-05
gi|50758913|ref|XP_417476.1| PREDICTED: similar to Hypothetical ...    50   5e-05
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis]         50   7e-05
gi|27503875|gb|AAH42244.1| MGC53372 protein [Xenopus laevis]           50   7e-05
gi|11526821|gb|AAG36793.1| nuclear receptor coactivator CIA [Hom...    49   1e-04
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc...    49   1e-04
gi|11544574|emb|CAC17668.1| dJ599F21.1 (KIAA1637) [Homo sapiens]       49   2e-04
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8]                 49   2e-04
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno...    49   2e-04
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno...    49   2e-04
gi|15147335|ref|NP_066018.1| nuclear receptor coactivator 5; coa...    49   2e-04
gi|46320109|ref|ZP_00220502.1| COG1530: Ribonucleases G and E [B...    48   3e-04
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [...    48   3e-04
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ...    48   3e-04
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno...    48   3e-04
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ...    47   4e-04
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno...    47   4e-04
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633...    47   6e-04
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel...    47   6e-04
gi|46316651|ref|ZP_00217230.1| COG1530: Ribonucleases G and E [B...    47   6e-04
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel...    47   7e-04
gi|29828894|ref|NP_823528.1| hypothetical protein SAV2352 [Strep...    47   7e-04
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno...    47   7e-04
gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ...    47   7e-04
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno...    46   0.001
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa...    46   0.001
gi|46431666|gb|EAK91201.1| hypothetical protein CaO19.9471 [Cand...    46   0.001
gi|17552718|ref|NP_498862.1| C.Elegans Chromodomain protein (33....    46   0.001
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa]                    46   0.001
gi|21228725|ref|NP_634647.1| Ribonuclease [Methanosarcina mazei ...    46   0.001
gi|34854792|ref|XP_218287.2| similar to putative odorant recepto...    45   0.002
gi|34868438|ref|XP_232942.2| similar to RIKEN cDNA 2610207I16 [R...    45   0.002
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus...    45   0.002
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto...    45   0.002
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus]     45   0.002
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    45   0.003
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ...    45   0.003
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi...    45   0.003
gi|38082410|ref|XP_144245.2| similar to microfibrillar-associate...    45   0.003
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno...    45   0.003
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ...    45   0.003
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno...    44   0.004
gi|23468050|ref|ZP_00123621.1| COG5295: Autotransporter adhesin ...    44   0.004
gi|21450271|ref|NP_659141.1| nuclear receptor coactivator 5 [Mus...    44   0.004
gi|50545197|ref|XP_500136.1| hypothetical protein [Yarrowia lipo...    44   0.004
gi|24650602|ref|NP_651554.1| CG3361-PA [Drosophila melanogaster]...    44   0.004
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno...    44   0.004
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ...    44   0.004
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ...    44   0.004
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD...    44   0.005
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens]        44   0.005
gi|4154097|gb|AAD04750.1| unknown [Human herpesvirus 8]                44   0.005
gi|1223914|gb|AAB47214.1| endo16 [Strongylocentrotus purpuratus]       44   0.005
gi|29245456|gb|EAA37093.1| GLP_227_3888_5990 [Giardia lamblia AT...    44   0.005
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu...    44   0.005
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens]        44   0.005
gi|45184892|ref|NP_982610.1| AAR069Wp [Eremothecium gossypii] >g...    44   0.005
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp...    44   0.005
gi|48094941|ref|XP_392215.1| similar to ENSANGP00000022213 [Apis...    44   0.005
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C...    44   0.006
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-...    44   0.006
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [...    44   0.006
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi]             44   0.006
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P...    43   0.008
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ...    43   0.008
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ...    43   0.008
gi|39104508|dbj|BAC65744.3| mKIAA1187 protein [Mus musculus]           43   0.008
gi|13591886|ref|NP_112257.1| microtubule-associated protein 1 A;...    43   0.008
gi|50255862|gb|EAL18593.1| hypothetical protein CNBJ0190 [Crypto...    43   0.008
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno...    43   0.008
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha...    43   0.008
gi|29827234|ref|NP_821868.1| hypothetical protein SAV693 [Strept...    43   0.008
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ...    43   0.011
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat...    43   0.011
gi|56619|emb|CAA47316.1| microtubule associated protein 1A [Ratt...    43   0.011
gi|23103184|ref|ZP_00089671.1| COG1530: Ribonucleases G and E [A...    43   0.011
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]...    43   0.011
gi|46431687|gb|EAK91221.1| hypothetical protein CaO19.1915 [Cand...    42   0.014
gi|13195670|ref|NP_077217.1| RIKEN cDNA 2610207I16 [Mus musculus...    42   0.014
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa]                    42   0.014
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa...    42   0.014
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno...    42   0.014
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno...    42   0.014
gi|13397923|emb|CAC34587.1| hypothetical protein [Mus musculus]        42   0.014
gi|34869750|ref|XP_223980.2| similar to RPGR-interacting protein...    42   0.014
gi|13811671|gb|AAK40236.1| glutamate-rich protein [Plasmodium re...    42   0.014
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno...    42   0.014
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa...    42   0.014
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet...    42   0.014
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii]    42   0.014
gi|50257630|gb|EAL20335.1| hypothetical protein CNBF1460 [Crypto...    42   0.014
gi|15829122|ref|NP_326482.1| predicted coding region [Mycoplasma...    42   0.014
gi|41191873|ref|XP_372978.1| similar to ENSANGP00000007346 [Homo...    42   0.018
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo...    42   0.018
gi|46444705|gb|EAL03978.1| hypothetical protein CaO19.4643 [Cand...    42   0.018
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can...    42   0.018
gi|38075633|ref|XP_194040.3| microtubule-associated protein 1 A ...    42   0.018
gi|4581463|emb|CAA70874.1| MEMA [Homo sapiens]                         42   0.024
gi|3021392|emb|CAA71377.1| nuclear protein SDK3 [Homo sapiens]         42   0.024
gi|23486190|gb|EAA20743.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [...    42   0.024
gi|46125615|ref|XP_387361.1| hypothetical protein FG07185.1 [Gib...    42   0.024
gi|42528111|ref|NP_973209.1| conserved hypothetical protein [Tre...    42   0.024
gi|6563230|gb|AAF17209.1| nuclear protein SDK3 [Homo sapiens]          42   0.024
gi|11320891|gb|AAG33941.1| pinin [Homo sapiens]                        42   0.024
gi|33356174|ref|NP_002678.2| pinin, desmosome associated protein...    42   0.024
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno...    42   0.024
gi|39597930|emb|CAE68622.1| Hypothetical protein CBG14509 [Caeno...    42   0.024
gi|38346074|emb|CAE04842.2| OSJNBa0084K01.14 [Oryza sativa (japo...    42   0.024
gi|39596219|emb|CAE69856.1| Hypothetical protein CBG16184 [Caeno...    42   0.024
gi|6325016|ref|NP_015084.1| Cytoplasmic chaperone (Hsp90 family)...    42   0.024
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand...    42   0.024
gi|31206533|ref|XP_312229.1| ENSANGP00000010897 [Anopheles gambi...    41   0.031
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib...    41   0.031
gi|21360802|gb|AAM49715.1| hepatoma-derived growth factor HGDF5 ...    41   0.031
gi|12083381|gb|AAG46367.1| antigen 38 [Trypanosoma cruzi]              41   0.031
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ...    41   0.031
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno...    41   0.031
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul...    41   0.031
gi|39580703|emb|CAE70383.1| Hypothetical protein CBG16944 [Caeno...    41   0.031
gi|18495763|emb|CAC87579.1| surface protein [Theileria annulata]       41   0.031
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ...    41   0.031
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-...    41   0.031
gi|46440639|gb|EAK99943.1| hypothetical protein CaO19.6260 [Cand...    41   0.031
gi|13472197|ref|NP_103764.1| unknown protein [Mesorhizobium loti...    41   0.031
gi|23613137|ref|NP_703459.1| hypothetical protein [Plasmodium fa...    41   0.031
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ...    41   0.041
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det...    41   0.041
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ...    41   0.041
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand...    41   0.041
gi|21357213|ref|NP_648884.1| CG4784-PA [Drosophila melanogaster]...    41   0.041
gi|23480798|gb|EAA17260.1| hypothetical protein [Plasmodium yoel...    41   0.041
gi|34871032|ref|XP_238415.2| similar to CDNA sequence BC019977 [...    41   0.041
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri...    41   0.041
gi|34860705|ref|XP_215931.2| similar to hypothetical protein MGC...    41   0.041
gi|32415113|ref|XP_328036.1| hypothetical protein [Neurospora cr...    41   0.041
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa]                    41   0.041
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD...    40   0.053
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [...    40   0.053
gi|23508912|ref|NP_701580.1| hypothetical protein [Plasmodium fa...    40   0.053
gi|31544707|ref|NP_853285.1| conserved hypothetical [Mycoplasma ...    40   0.053
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >...    40   0.053
gi|1711421|sp|P54705|SNWA_DICDI Protein snwA >gnl|BL_ORD_ID|9602...    40   0.053
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her...    40   0.053
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno...    40   0.053
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno...    40   0.053
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ...    40   0.053
gi|6677817|ref|NP_033126.1| repetin [Mus musculus] >gnl|BL_ORD_I...    40   0.053
gi|32410635|ref|XP_325798.1| hypothetical protein [Neurospora cr...    40   0.053
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa]                    40   0.053
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno...    40   0.053
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par...    40   0.053
gi|50806838|ref|XP_428858.1| PREDICTED: similar to tumor-related...    40   0.070
gi|50408706|ref|XP_456805.1| unnamed protein product [Debaryomyc...    40   0.070
gi|21755300|dbj|BAC04654.1| unnamed protein product [Homo sapiens]     40   0.070
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot...    40   0.070
gi|23507976|ref|NP_700646.1| hypothetical protein [Plasmodium fa...    40   0.070
gi|27802723|emb|CAD60828.1| SI:bZ1D10.2 (novel protein similar t...    40   0.070
gi|23613722|ref|NP_704743.1| hypothetical protein [Plasmodium fa...    40   0.070
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno...    40   0.070
gi|50260382|gb|EAL23041.1| hypothetical protein CNBA8080 [Crypto...    40   0.070
gi|7022325|dbj|BAA91557.1| unnamed protein product [Homo sapiens...    40   0.070
gi|45501333|gb|AAH67256.1| FLJ10350 protein [Homo sapiens]             40   0.070
gi|1684847|gb|AAB48304.1| pinin [Homo sapiens]                         40   0.070
gi|48095295|ref|XP_394403.1| similar to ENSANGP00000017739 [Apis...    40   0.070
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor...    40   0.070
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass...    40   0.070
gi|20521788|dbj|BAA86501.2| KIAA1187 protein [Homo sapiens]            40   0.070
gi|18043435|gb|AAH19977.1| BC019977 protein [Mus musculus]             40   0.091
gi|49078064|ref|XP_402822.1| hypothetical protein UM05207.1 [Ust...    40   0.091
gi|482391|pir||A45555 glutamate rich protein - malaria parasite ...    40   0.091
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna...    40   0.091
gi|23508147|ref|NP_700817.1| glutamate-rich protein [Plasmodium ...    40   0.091
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno...    40   0.091
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738...    40   0.091
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc...    40   0.091
gi|31542192|ref|NP_659190.2| cDNA sequence BC019977 [Mus musculu...    40   0.091
gi|16359231|gb|AAH16081.1| BC019977 protein [Mus musculus]             40   0.091
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu...    40   0.091
gi|50555672|ref|XP_505244.1| hypothetical protein [Yarrowia lipo...    40   0.091
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a...    40   0.091
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [...    40   0.091
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno...    40   0.091
gi|50420149|ref|XP_458607.1| unnamed protein product [Debaryomyc...    40   0.091
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano...    40   0.091
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|...    39   0.12
gi|10047263|dbj|BAB13420.1| KIAA1594 protein [Homo sapiens]            39   0.12
gi|39593633|emb|CAE61925.1| Hypothetical protein CBG05922 [Caeno...    39   0.12
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL...    39   0.12
gi|23619067|ref|NP_705029.1| hypothetical protein [Plasmodium fa...    39   0.12
gi|34865262|ref|XP_343068.1| similar to pinin; DNA segment, Chr ...    39   0.12
gi|19115337|ref|NP_594425.1| carboxypeptidase y [Schizosaccharom...    39   0.12
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami...    39   0.12
gi|34867971|ref|XP_347238.1| similar to pinin; DNA segment, Chr ...    39   0.12
gi|33187703|gb|AAP97706.1| hepatoma-derived growth factor varian...    39   0.12
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043...    39   0.12
gi|26986619|ref|NP_758501.1| coiled-coil domain containing 9 [Mu...    39   0.12
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa...    39   0.12
gi|17509691|ref|NP_493400.1| putative protein, with 2 coiled coi...    39   0.12
gi|47498038|ref|NP_998865.1| hypothetical protein MGC69319 [Xeno...    39   0.12
gi|45552531|ref|NP_995788.1| CG1794-PB [Drosophila melanogaster]...    39   0.12
gi|47221067|emb|CAG12761.1| unnamed protein product [Tetraodon n...    39   0.12
gi|45550395|ref|NP_610511.2| CG1794-PA [Drosophila melanogaster]...    39   0.12
gi|32422843|ref|XP_331865.1| hypothetical protein [Neurospora cr...    39   0.12
gi|48474402|sp|Q86T82|UB37_HUMAN Ubiquitin carboxyl-terminal hyd...    39   0.12
gi|15903166|ref|NP_358716.1| Cell division protein FtsY [Strepto...    39   0.12
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate...    39   0.12
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno...    39   0.12
gi|38567183|emb|CAE76476.1| related to zinc finger protein crol ...    39   0.12
gi|50555293|ref|XP_505055.1| hypothetical protein [Yarrowia lipo...    39   0.12
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me...    39   0.15
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p...    39   0.15
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi...    39   0.15
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D...    39   0.15
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster...    39   0.15
gi|21673259|ref|NP_661324.1| magnesium-chelatase, subunit D/I fa...    39   0.15
gi|27461725|gb|AAN05017.1| pinin [Mus musculus]                        39   0.15
gi|29251008|gb|EAA42494.1| GLP_587_87663_89534 [Giardia lamblia ...    39   0.15
gi|34327950|dbj|BAA20761.2| KIAA0301 [Homo sapiens]                    39   0.15
gi|16768468|gb|AAL28453.1| GM05229p [Drosophila melanogaster]          39   0.15
gi|4884691|gb|AAD31770.1| lactoferrin-binding protein precursor ...    39   0.15
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster...    39   0.15
gi|39593112|emb|CAE64581.1| Hypothetical protein CBG09334 [Caeno...    39   0.15
gi|32406504|ref|XP_323865.1| hypothetical protein [Neurospora cr...    39   0.15
gi|46439770|gb|EAK99084.1| hypothetical protein CaO19.13178 [Can...    39   0.15
gi|124738|sp|P24711|INVO_TARBA Involucrin >gnl|BL_ORD_ID|1371644...    39   0.15
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster...    39   0.15
gi|26326913|dbj|BAC27200.1| unnamed protein product [Mus musculus]     39   0.15
gi|24415404|ref|NP_055426.1| MDN1, midasin homolog [Homo sapiens...    39   0.15
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628...    39   0.20
gi|50302725|ref|XP_451299.1| unnamed protein product [Kluyveromy...    39   0.20
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib...    39   0.20
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno...    39   0.20
gi|23486500|gb|EAA20810.1| unknown protein, putative [Plasmodium...    39   0.20
gi|6679407|ref|NP_032917.1| pinin [Mus musculus] >gnl|BL_ORD_ID|...    39   0.20
gi|50286247|ref|XP_445552.1| unnamed protein product [Candida gl...    39   0.20
gi|39586240|emb|CAE66651.1| Hypothetical protein CBG11988 [Caeno...    39   0.20
gi|45477539|gb|AAS66085.1| LMW glutenin pGM107 [Triticum aestivum]     39   0.20
gi|17425188|dbj|BAB78749.1| low-molecular-weight glutenin subuni...    39   0.20
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (...    39   0.20
gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephr...    39   0.20
gi|42780042|ref|NP_977289.1| collagen adhesin domain protein [Ba...    39   0.20
gi|47227185|emb|CAG00547.1| unnamed protein product [Tetraodon n...    39   0.20
gi|24374614|ref|NP_718657.1| TPR domain protein [Shewanella onei...    39   0.20
gi|15241453|ref|NP_199241.1| zinc finger (C3HC4-type RING finger...    39   0.20
gi|41054992|ref|NP_955762.1| hypothetical protein D430021I08 [Mu...    38   0.26
gi|46438009|gb|EAK97347.1| hypothetical protein CaO19.5274 [Cand...    38   0.26
gi|10048257|gb|AAG12326.1| glutamate-rich protein [Plasmodium fa...    38   0.26
gi|50083265|gb|AAT70227.1| chromogranin A [Macaca mulatta]             38   0.26
gi|7512088|pir||T30282 calcium-binding protein - sea urchin (Str...    38   0.26
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA...    38   0.26
gi|124732|sp|P17941|INVO_HYLLA Involucrin >gnl|BL_ORD_ID|1811533...    38   0.26
gi|18376049|emb|CAD21055.1| hypothetical protein [Neurospora cra...    38   0.26
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal...    38   0.26
gi|23484531|gb|EAA19833.1| hypothetical protein [Plasmodium yoel...    38   0.26
gi|41054766|ref|NP_956894.1| hypothetical protein MGC63522 [Dani...    38   0.26
gi|50428167|ref|XP_458990.1| unnamed protein product [Debaryomyc...    38   0.26
gi|50284883|ref|XP_444869.1| unnamed protein product [Candida gl...    38   0.26
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C...    38   0.26
gi|15223313|ref|NP_174560.1| hypothetical protein [Arabidopsis t...    38   0.26
gi|32413314|ref|XP_327137.1| predicted protein [Neurospora crass...    38   0.26
gi|23486147|gb|EAA20734.1| hypothetical protein [Plasmodium yoel...    38   0.26
gi|32411243|ref|XP_326102.1| hypothetical protein [Neurospora cr...    38   0.26
gi|1828|emb|CAA35992.1| trichohyalin [Ovis sp.]                        38   0.26
gi|24639723|ref|NP_572179.1| CG15473-PA [Drosophila melanogaster...    38   0.35
gi|47211593|emb|CAF89734.1| unnamed protein product [Tetraodon n...    38   0.35
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster...    38   0.35
gi|42519751|ref|NP_965681.1| hypothetical protein LJ0574 [Lactob...    38   0.35
gi|4589406|dbj|BAA76748.1| chromogranin A [Equus caballus]             38   0.35
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr...    38   0.35
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno...    38   0.35
gi|17137794|ref|NP_477504.1| CG9280-PA [Drosophila melanogaster]...    38   0.35
gi|9910552|ref|NP_064475.1| sodium/calcium/potassium exchanger [...    38   0.35
gi|40225646|gb|AAH09384.2| CHGA protein [Homo sapiens]                 38   0.35
gi|1709130|sp|P50535|MSL1_DROME Male-specific lethal-1 protein >...    38   0.35
gi|6832905|sp|P10645|CMGA_HUMAN Chromogranin A precursor (CgA) (...    38   0.35
gi|1070547|pir||A28468 chromogranin A precursor [validated] - hu...    38   0.35
gi|24654027|ref|NP_725526.1| CG8421-PD [Drosophila melanogaster]...    38   0.35
gi|7494392|pir||T18414 protein g377 - malaria parasite (Plasmodi...    38   0.35
gi|4502805|ref|NP_001266.1| chromogranin A; parathyroid secretor...    38   0.35
gi|23509173|ref|NP_701841.1| PFG377 protein [Plasmodium falcipar...    38   0.35
gi|37361824|gb|AAQ91025.1| LRRGT00069 [Rattus norvegicus]              38   0.35
gi|24654024|ref|NP_725525.1| CG8421-PA [Drosophila melanogaster]...    38   0.35
gi|42734273|emb|CAF31485.1| Hypothetical protein T05F1.6 [Caenor...    38   0.35
gi|21361781|ref|NP_060537.2| hypothetical protein FLJ10350 [Homo...    38   0.35
gi|50421413|ref|XP_459257.1| unnamed protein product [Debaryomyc...    38   0.35
gi|17647175|ref|NP_523757.1| CG8421-PB [Drosophila melanogaster]...    38   0.35
gi|28829482|gb|AAL92370.2| similar to Dictyostelium discoideum (...    38   0.35
gi|15425631|dbj|BAB64303.1| beta-conglycinin alpha prime subunit...    38   0.35
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi...    38   0.35
gi|2133691|pir||S52959 male-specific lethal-1 protein - fruit fl...    38   0.35
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl...    38   0.35
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster]          38   0.35
gi|30583993|gb|AAP36245.1| Homo sapiens chromogranin A (parathyr...    38   0.35
gi|17508885|ref|NP_492556.1| complex locus; 3' and 5' of differe...    38   0.35
gi|124736|sp|P14708|INVO_PONPY Involucrin >gnl|BL_ORD_ID|1318093...    38   0.35
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis]            38   0.35
gi|24662337|ref|NP_648415.1| CG6409-PA [Drosophila melanogaster]...    38   0.35
gi|39593222|emb|CAE64691.1| Hypothetical protein CBG09473 [Caeno...    37   0.45
gi|124734|sp|P14591|INVO_PANPA Involucrin >gnl|BL_ORD_ID|553935 ...    37   0.45
gi|46125321|ref|XP_387214.1| hypothetical protein FG07038.1 [Gib...    37   0.45
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa]       37   0.45
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa...    37   0.45
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati...    37   0.45
gi|45201062|ref|NP_986632.1| AGL034Cp [Eremothecium gossypii] >g...    37   0.45
gi|7513577|pir||T34518 nestin - golden hamster (fragment) >gnl|B...    37   0.45
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w...    37   0.45
gi|47216984|emb|CAG04926.1| unnamed protein product [Tetraodon n...    37   0.45
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g...    37   0.45
gi|12060990|gb|AAG48331.1| lost on transformation protein 1 [Mus...    37   0.45
gi|42660863|ref|XP_064152.5| sarcalumenin [Homo sapiens]               37   0.45
gi|15425681|dbj|BAB64297.1| I-connectin [Procambarus clarkii]          37   0.45
gi|19112828|ref|NP_596036.1| hypothetical coiled-coil protein [S...    37   0.45
gi|13385186|ref|NP_080001.1| RIKEN cDNA 4921513E08 [Mus musculus...    37   0.45
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ...    37   0.45
gi|31198993|ref|XP_308444.1| ENSANGP00000017898 [Anopheles gambi...    37   0.45
gi|6978026|gb|AAF34245.1| zinc finger protein ZAC1 [Mus musculus]      37   0.45
gi|7505675|pir||T32092 hypothetical protein K09F6.6 - Caenorhabd...    37   0.45
gi|17158415|ref|NP_477835.1| wsv313 [shrimp white spot syndrome ...    37   0.45
gi|33329236|gb|AAQ10018.1| putative esophageal gland cell secret...    37   0.45
gi|25148570|ref|NP_740973.1| M protein repeat containing protein...    37   0.45
gi|15021546|gb|AAK77823.1| ORF154 [shrimp white spot syndrome vi...    37   0.45
gi|23509702|ref|NP_702369.1| hypothetical protein [Plasmodium fa...    37   0.45
gi|38089141|ref|XP_146248.3| MYST histone acetyltransferase (mon...    37   0.59
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat...    37   0.59
gi|24658452|ref|NP_729078.1| CG10596-PC [Drosophila melanogaster...    37   0.59
gi|26988635|ref|NP_744060.1| ribonuclease E [Pseudomonas putida ...    37   0.59
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule           37   0.59
gi|42568895|ref|NP_178414.2| ATP/GTP-binding protein family [Ara...    37   0.59
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib...    37   0.59
gi|29346315|ref|NP_809818.1| BatC, conserved hypothetical protei...    37   0.59
gi|23619032|ref|NP_704994.1| hypothetical protein [Plasmodium fa...    37   0.59
gi|17136772|ref|NP_476896.1| CG10385-PA [Drosophila melanogaster...    37   0.59
gi|24654914|ref|NP_728554.1| CG32479-PA [Drosophila melanogaster...    37   0.59
gi|50744910|ref|XP_419932.1| PREDICTED: similar to myelin transc...    37   0.59
gi|24658445|ref|NP_729077.1| CG10596-PA [Drosophila melanogaster...    37   0.59
gi|40786547|ref|NP_037407.3| ankyrin repeat domain 11; nasophary...    37   0.59
gi|25013014|gb|AAN71591.1| RH50422p [Drosophila melanogaster]          37   0.59
gi|18495789|emb|CAC87892.1| surface protein [Theileria annulata]       37   0.59
gi|17550336|ref|NP_510658.1| TBP-Associated transcription Factor...    37   0.59
gi|15600941|ref|NP_232571.1| conserved hypothetical protein [Vib...    37   0.59
gi|42767029|gb|AAS45544.1| ankyrin repeat-containing cofactor-1 ...    37   0.59
gi|29251308|gb|EAA42790.1| GLP_574_10064_7116 [Giardia lamblia A...    37   0.59
gi|34783699|gb|AAH58001.1| ANKRD11 protein [Homo sapiens]              37   0.59
gi|34394194|dbj|BAC84646.1| hypothetical protein [Oryza sativa (...    37   0.59
gi|7487146|pir||T02711 probable calmodulin [imported] - Arabidop...    37   0.59
gi|50290715|ref|XP_447790.1| unnamed protein product [Candida gl...    37   0.59
gi|1709011|sp|P55080|MFA1_CHICK MICROFIBRILLAR-ASSOCIATED PROTEI...    37   0.59
gi|21355467|ref|NP_647973.1| CG10596-PB [Drosophila melanogaster...    37   0.59
gi|7499530|pir||T21174 hypothetical protein F20G4.3 - Caenorhabd...    37   0.59
gi|7508112|pir||T25061 hypothetical protein T21B6.3 - Caenorhabd...    37   0.59
gi|30424814|ref|NP_780402.1| golgi phosphoprotein 4 [Mus musculu...    37   0.59
gi|34881305|ref|XP_228502.2| similar to hypothetical protein FLJ...    37   0.59
gi|25152272|ref|NP_509829.2| brain-specific angiogenesis inhibit...    37   0.59
gi|14530418|emb|CAA99841.2| Hypothetical protein F20G4.3 [Caenor...    37   0.59
gi|1477559|gb|AAC47238.1| non-muscle myosin heavy chain II             37   0.59
gi|23507807|ref|NP_700477.1| erythrocyte membrane protein 1 (PfE...    37   0.59
gi|25150089|ref|NP_492186.2| non-muscle myosin, cytoplasmic, hea...    37   0.59
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis]            37   0.77
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida...    37   0.77
gi|50838800|ref|NP_001002867.1| wu:fi26c04 [Danio rerio] >gnl|BL...    37   0.77
gi|23509422|ref|NP_702089.1| hypothetical protein [Plasmodium fa...    37   0.77
gi|47223062|emb|CAG07149.1| unnamed protein product [Tetraodon n...    37   0.77
gi|2146901|pir||S12519 glutactin - fruit fly (Drosophila melanog...    37   0.77
gi|23509816|ref|NP_702483.1| hypothetical protein [Plasmodium fa...    37   0.77
gi|32698944|ref|NP_872367.1| hypothetical protein FLJ36144 [Homo...    37   0.77
gi|50259202|gb|EAL21875.1| hypothetical protein CNBC0160 [Crypto...    37   0.77
gi|34869806|ref|XP_341016.1| similar to Pcqap protein [Rattus no...    37   0.77
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ...    37   0.77
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ...    37   0.77
gi|951373|gb|AAA74653.1| unknown protein                               37   0.77
gi|16877757|gb|AAH17115.1| POLR1A protein [Homo sapiens]               37   0.77
gi|10438121|dbj|BAB15171.1| unnamed protein product [Homo sapiens]     37   0.77
gi|50761561|ref|XP_424765.1| PREDICTED: similar to hypothetical ...    37   0.77
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n...    37   0.77
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc...    37   0.77
gi|49085954|ref|XP_405060.1| hypothetical protein AN0923.2 [Aspe...    37   0.77
gi|50755015|ref|XP_414583.1| PREDICTED: similar to Ras-GTPase-ac...    37   0.77
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand...    37   0.77
gi|32421111|ref|XP_330999.1| hypothetical protein [Neurospora cr...    37   0.77
gi|46122089|ref|XP_385598.1| hypothetical protein FG05422.1 [Gib...    37   0.77
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl...    37   0.77
gi|30023824|ref|NP_835229.1| similar to delta 5 fatty acid desat...    37   0.77
gi|24664506|ref|NP_648752.1| CG12316-PA [Drosophila melanogaster...    37   0.77
gi|15238219|ref|NP_196627.1| calmodulin-binding protein-related ...    37   0.77
gi|17534051|ref|NP_494060.1| predicted CDS, merozoite surface li...    37   0.77
gi|45478244|gb|AAS66293.1| LRRGT00202 [Rattus norvegicus]              36   1.0
gi|46561854|gb|AAT01144.1| soft fertilization envelope protein 9...    36   1.0
gi|46125761|ref|XP_387434.1| hypothetical protein FG07258.1 [Gib...    36   1.0
gi|29247833|gb|EAA39384.1| GLP_336_40147_37625 [Giardia lamblia ...    36   1.0
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand...    36   1.0
gi|11346371|pir||T47235 sex determining protein [imported] - wes...    36   1.0
gi|14250969|ref|NP_116331.1| T2 [Tupaia herpesvirus] >gnl|BL_ORD...    36   1.0
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ...    36   1.0
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis]            36   1.0
gi|7508682|pir||T15138 hypothetical protein T28F2.4 - Caenorhabd...    36   1.0
gi|45200797|ref|NP_986367.1| AGL300Cp [Eremothecium gossypii] >g...    36   1.0
gi|50287799|ref|XP_446329.1| unnamed protein product [Candida gl...    36   1.0
gi|21755932|dbj|BAC04789.1| unnamed protein product [Homo sapiens]     36   1.0
gi|47220115|emb|CAF99028.1| unnamed protein product [Tetraodon n...    36   1.0
gi|19481961|gb|AAL89237.1| WSSV369 [shrimp white spot syndrome v...    36   1.0
gi|39582461|emb|CAE66552.1| Hypothetical protein CBG11864 [Caeno...    36   1.0
gi|32417804|ref|XP_329380.1| predicted protein [Neurospora crass...    36   1.0
gi|39583277|emb|CAE60069.1| Hypothetical protein CBG03586 [Caeno...    36   1.0
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot...    36   1.0
gi|32420109|ref|XP_330498.1| hypothetical protein [Neurospora cr...    36   1.0
gi|23510180|ref|NP_702846.1| ran binding protein 1 [Plasmodium f...    36   1.0
gi|15238640|ref|NP_197870.1| expressed protein [Arabidopsis thal...    36   1.0
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ...    36   1.0
gi|17505380|ref|NP_492788.1| putative nuclear protein (1L226) [C...    36   1.0
gi|8567376|ref|NP_059507.1| MYST histone acetyltransferase monoc...    36   1.0
gi|32411685|ref|XP_326323.1| hypothetical protein [Neurospora cr...    36   1.0
gi|41059833|gb|AAR99384.1| surface protein BVH-11 [Streptococcus...    36   1.0
gi|42783878|ref|NP_981125.1| FtsK/SpoIIIE family protein [Bacill...    36   1.0
gi|23510135|ref|NP_702801.1| hypothetical protein [Plasmodium fa...    36   1.0
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi...    36   1.0
gi|47211190|emb|CAG12349.1| unnamed protein product [Tetraodon n...    36   1.0
gi|38084908|ref|XP_357051.1| similar to sperm protein SSP3111; s...    36   1.0
gi|7531129|sp|O85467|GRIA_BACCE Spore germination protein gerIA ...    36   1.0
gi|33243891|gb|AAQ01512.1| histone acetyltransferase querkopf [M...    36   1.0
gi|50417888|ref|XP_457732.1| unnamed protein product [Debaryomyc...    36   1.0
gi|46237537|emb|CAE83918.1| death domain-associated protein [Rat...    36   1.0
gi|1082285|pir||H54024 protein kinase (EC 2.7.1.37) cdc2-related...    36   1.0
gi|17509325|ref|NP_491190.1| MDIG like (86.0 kD) (1E200) [Caenor...    36   1.0
gi|17555622|ref|NP_498151.1| g-protein beta WD-40 repeat (3G476)...    36   1.0
gi|11360390|pir||T46608 zinc finger protein Png-1 - mouse >gnl|B...    36   1.0
gi|41106697|ref|XP_371312.1| hypothetical protein FLJ39117 [Homo...    36   1.0
gi|755081|gb|AAB00073.1| schizont/sporozoite surface protein >gn...    36   1.0
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid...    36   1.0
gi|42733836|gb|AAS38754.1| hypothetical protein [Dictyostelium d...    36   1.0
gi|7494988|pir||T33121 hypothetical protein B0511.11 - Caenorhab...    36   1.0
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli...    36   1.0
gi|19115664|ref|NP_594752.1| hypothetical protein [Schizosacchar...    36   1.3
gi|49106457|ref|XP_411428.1| hypothetical protein AN7291.2 [Aspe...    36   1.3
gi|39582708|emb|CAE65914.1| Hypothetical protein CBG11081 [Caeno...    36   1.3
gi|22024201|ref|NP_611354.2| CG30122-PB [Drosophila melanogaster...    36   1.3
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno...    36   1.3
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis]            36   1.3
gi|24286732|gb|AAN46886.1| nucleotide exchange factor RasGEF R [...    36   1.3
gi|31203169|ref|XP_310533.1| ENSANGP00000017306 [Anopheles gambi...    36   1.3
gi|32422107|ref|XP_331497.1| predicted protein [Neurospora crass...    36   1.3
gi|47218804|emb|CAG02789.1| unnamed protein product [Tetraodon n...    36   1.3
gi|21401240|ref|NP_657225.1| hypothetical protein predicted by G...    36   1.3
gi|41117725|ref|XP_372917.1| similar to Cerebellar-degeneration-...    36   1.3
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [...    36   1.3
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma...    36   1.3
gi|18266690|ref|NP_543167.1| Fas death domain-associated protein...    36   1.3
gi|50404847|ref|YP_053939.1| DNA-binding protein, putative [Para...    36   1.3
gi|32033879|ref|ZP_00134150.1| COG0810: Periplasmic protein TonB...    36   1.3
gi|28829491|gb|AAO52024.1| similar to Dictyostelium discoideum (...    36   1.3
gi|47212361|emb|CAF89926.1| unnamed protein product [Tetraodon n...    36   1.3
gi|401496|sp|P31568|YCF2_OENPI Protein ycf2 >gnl|BL_ORD_ID|27360...    36   1.3
gi|16552857|dbj|BAB71393.1| unnamed protein product [Homo sapiens]     36   1.3
gi|32417556|ref|XP_329256.1| hypothetical protein [Neurospora cr...    36   1.3
gi|11321712|gb|AAG34192.1| L3836.7 [Leishmania major]                  36   1.3
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi...    36   1.3
gi|39586045|emb|CAE69121.1| Hypothetical protein CBG15147 [Caeno...    36   1.3
gi|1684845|gb|AAB48303.1| pinin [Canis familiaris]                     36   1.3
gi|992950|dbj|BAA05951.1| OPN-c [Homo sapiens]                         36   1.3
gi|49186125|ref|YP_029377.1| lipoprotein, putative [Bacillus ant...    36   1.3


>gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD)
           (col-106) [Caenorhabditis elegans]
 gi|22532857|gb|AAM97984.1| Collagen protein 106 [Caenorhabditis
           elegans]
          Length = 296

 Score =  221 bits (563), Expect = 2e-56
 Identities = 146/296 (49%), Positives = 146/296 (49%)
 Frame = -1

Query: 891 MGAFGTLACASATVLTIGSLATMCLIVSDINGLYNDVMEESRTTREVADDAWEELLRKNG 712
           MGAFGTLACASATVLTIGSLATMCLIVSDINGLYNDVMEESRTTREVADDAWEELLRKNG
Sbjct: 1   MGAFGTLACASATVLTIGSLATMCLIVSDINGLYNDVMEESRTTREVADDAWEELLRKNG 60

Query: 711 APEASRAAVTAMLFGRNKRNAQCNCGAKSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 532
           APEASRAAVTAMLFGRNKRNAQCNCGAKSK
Sbjct: 61  APEASRAAVTAMLFGRNKRNAQCNCGAKSKGCPAGPPGPRGPNGAPGLDGPDGLDGPDGH 120

Query: 531 XGYAAAIKENFXXXXXXXXXXXXXXXXXXXXXXXXGTDGAPGEDXXXXXXXXXXXXXXXX 352
            GYAAAIKENF                        GTDGAPGED
Sbjct: 121 PGYAAAIKENFGGACISCPAGPAGPPGPDGCAGEPGTDGAPGEDGQNGAPGSPGGPGETG 180

Query: 351 XXXXXXXXXXXXXXXXXXXXGQTYLPGSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 172
                               GQTYLPGSA
Sbjct: 181 PQGHQGKPGRAGPRGPPGAKGQTYLPGSAGHPGNSGRRGPPGPPGANGKNGKQGADGIPG 240

Query: 171 XXXXXXXXXXXGVXXXXXXXXXXXXXXXXXAYCPCPTRSVAVEAAPSQAEQIYKTH 4
                      GV                 AYCPCPTRSVAVEAAPSQAEQIYKTH
Sbjct: 241 AGGAPGQHGVPGVDGSDGAPGEDAAPGGDAAYCPCPTRSVAVEAAPSQAEQIYKTH 296




[DB home][top]