Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= ZC410_5
         (525 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17544496|ref|NP_501579.1| microfilariae surface-associated pr...   285   3e-76
gi|34556102|emb|CAE46688.1| Hypothetical protein ZC410.5b [Caeno...   245   3e-64
gi|39586444|emb|CAE74103.1| Hypothetical protein CBG21763 [Caeno...   212   3e-54
gi|38606324|gb|AAR25200.1| surface-associated antigen 1 [Ancylos...   174   8e-43
gi|45602845|gb|AAA63412.2| microfilariae surface-associated prot...    89   5e-17
gi|345385|pir||A45649 microfilarial surface-associated antigen -...    80   2e-14
gi|42573662|ref|NP_974927.1| expressed protein [Arabidopsis thal...    43   0.004
gi|22327782|ref|NP_200054.2| expressed protein [Arabidopsis thal...    43   0.004
gi|18491169|gb|AAL69487.1| unknown protein [Arabidopsis thaliana]      43   0.004
gi|10177407|dbj|BAB10538.1| unnamed protein product [Arabidopsis...    43   0.004
gi|41615048|ref|NP_963546.1| NEQ256 [Nanoarchaeum equitans Kin4-...    40   0.018
gi|49618967|gb|AAT68068.1| SRF6-like [Danio rerio]                     40   0.024
gi|41055072|ref|NP_957359.1| similar to surfeit gene 6 [Danio re...    40   0.024
gi|42733967|gb|AAS38867.1| similar to K08H10.2a.p [Caenorhabditi...    39   0.054
gi|34525768|gb|AAQ73930.1| erythrocyte membrane protein 1 [Plasm...    38   0.091
gi|17557508|ref|NP_504391.1| putative protein family member, wit...    38   0.12
gi|27503448|gb|AAH42350.1| 1i973-prov protein [Xenopus laevis]         37   0.16
gi|50288719|ref|XP_446789.1| unnamed protein product [Candida gl...    37   0.20
gi|45190651|ref|NP_984905.1| AER045Cp [Eremothecium gossypii] >g...    37   0.27
gi|9630582|ref|NP_047129.1| putative tail tape measure protein [...    36   0.45
gi|20127150|ref|NP_061218.2| golgi autoantigen, golgin subfamily...    35   0.59
gi|18977093|ref|NP_578450.1| hypothetical protein PF0721 [Pyroco...    35   0.59
gi|22036412|gb|AAM89626.1| IpaD [Escherichia coli]                     35   0.59
gi|22036310|gb|AAM89575.1| IpaD [Shigella boydii] >gnl|BL_ORD_ID...    35   0.59
gi|22036370|gb|AAM89605.1| IpaD [Shigella dysenteriae]                 35   0.59
gi|6323340|ref|NP_013412.1| Protein involved in vesicular transp...    35   0.59
gi|12644578|sp|Q9I8B0|SUR6_XENLA Surfeit locus protein 6 homolog...    35   0.59
gi|17228817|ref|NP_485365.1| unknown protein [Nostoc sp. PCC 712...    35   0.59
gi|47211244|emb|CAF95043.1| unnamed protein product [Tetraodon n...    35   0.59
gi|15223458|ref|NP_176007.1| nucleolar protein Nop56, putative [...    35   0.77
gi|46134375|ref|ZP_00157798.2| COG0457: FOG: TPR repeat [Anabaen...    35   0.77
gi|42561540|ref|NP_975991.1| Hypothetical protein MSC_1027 [Myco...    35   0.77
gi|45383828|ref|NP_989473.1| vav 2 oncogene [Gallus gallus] >gnl...    35   0.77
gi|23479289|gb|EAA16160.1| rhoptry protein, putative [Plasmodium...    35   1.0
gi|22036344|gb|AAM89592.1| IpaD [Shigella flexneri]                    35   1.0
gi|2498990|sp|Q94819|TE95_TETTH Telomerase component p95 >gnl|BL...    35   1.0
gi|49068184|ref|XP_398381.1| hypothetical protein UM00766.1 [Ust...    34   1.3
gi|38085189|ref|XP_355166.1| similar to CG5882-PA [Mus musculus]       34   1.3
gi|34864207|ref|XP_219988.2| similar to CG5882-PA [Rattus norveg...    34   1.3
gi|37533914|ref|NP_921259.1| putative retroelement [Oryza sativa...    34   1.3
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap...    34   1.3
gi|22036382|gb|AAM89611.1| IpaD [Shigella sonnei]                      34   1.3
gi|130439|sp|P03304|POLG_EMCV Genome polyprotein [Contains: Coat...    34   1.3
gi|22036332|gb|AAM89586.1| IpaD [Shigella boydii]                      34   1.3
gi|23487793|gb|EAA21147.1| protein mix-1, putative [Plasmodium y...    34   1.3
gi|729141|sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 >gnl|BL...    34   1.3
gi|37362641|ref|NP_010853.2| Kinesin motor protein involved in m...    34   1.3
gi|2981488|gb|AAC06323.1| M protein [Streptococcus pyogenes]           34   1.3
gi|50083986|ref|YP_045496.1| hypothetical protein ACIAD0770 [Aci...    34   1.7
gi|15614072|ref|NP_242375.1| methyl-accepting chemotaxis protein...    34   1.7
gi|32307019|gb|AAP78989.1| IpaD [Shigella flexneri]                    34   1.7
gi|23510041|ref|NP_702707.1| sequestrin [Plasmodium falciparum 3...    34   1.7
gi|25406299|pir||B96766 protein kinesin F2P9.27 [imported] - Ara...    34   1.7
gi|23509249|ref|NP_701916.1| hypothetical protein, conserved [Pl...    34   1.7
gi|22036346|gb|AAM89593.1| IpaD [Shigella flexneri] >gnl|BL_ORD_...    34   1.7
gi|22036314|gb|AAM89577.1| IpaD [Shigella boydii] >gnl|BL_ORD_ID...    34   1.7
gi|17533681|ref|NP_496741.1| von Willebrand factor, type A and c...    34   1.7
gi|130442|sp|P12296|POLG_ENMGO Genome polyprotein [Contains: Coa...    34   1.7
gi|27498927|ref|XP_089747.2| similar to CG5882-PA [Homo sapiens]       34   1.7
gi|12324217|gb|AAG52083.1| kinesin-related protein; 103921-99132...    34   1.7
gi|22022406|gb|AAM81595.1| invasion plasmid antigen IpaD [Escher...    34   1.7
gi|22330608|ref|NP_177527.2| kinesin motor protein-related [Arab...    34   1.7
gi|46309087|emb|CAE84565.1| polyprotein [Encephalomyocarditis vi...    34   1.7
gi|11497151|ref|NP_051288.1| ErpY; outer surface protein F [Borr...    34   1.7
gi|46309091|emb|CAE84567.1| polyprotein [Encephalomyocarditis vi...    34   1.7
gi|417505|sp|P32540|POLG_ENMG3 Genome polyprotein [Contains: Coa...    34   1.7
gi|46309089|emb|CAE84566.1| polyprotein [Encephalomyocarditis vi...    34   1.7
gi|46309085|emb|CAE84564.1| polyprotein [Encephalomyocarditis vi...    34   1.7
gi|46309093|emb|CAE84568.1| polyprotein [Encephalomyocarditis vi...    34   1.7
gi|23613557|ref|NP_704578.1| hypothetical protein [Plasmodium fa...    34   1.7
gi|320010|pir||GNNYMV genome polyprotein - Mengo virus (strain 3...    34   1.7
gi|3542|emb|CAA77885.1| Cin8p [Saccharomyces cerevisiae] >gnl|BL...    34   1.7
gi|17533679|ref|NP_496742.1| von Willebrand factor, type A and c...    34   1.7
gi|23100190|ref|NP_693657.1| phage infection protein [Oceanobaci...    34   1.7
gi|15081481|ref|NP_149994.1| ParB protein [Clostridium perfringe...    34   1.7
gi|347393|gb|AAA46547.1| polyprotein                                   34   1.7
gi|15892845|ref|NP_360559.1| patatin b1 precursor [Rickettsia co...    33   2.3
gi|50307623|ref|XP_453791.1| unnamed protein product [Kluyveromy...    33   2.3
gi|26553608|ref|NP_757542.1| predicted cytoskeletal protein [Myc...    33   2.3
gi|23099464|ref|NP_692930.1| alanyl-tRNA synthetase [Oceanobacil...    33   2.3
gi|23510057|ref|NP_702723.1| hypothetical protein [Plasmodium fa...    33   2.3
gi|31234759|ref|XP_319111.1| ENSANGP00000022333 [Anopheles gambi...    33   2.3
gi|14520575|ref|NP_126050.1| chromosome segregation protein smc1...    33   2.9
gi|1707281|gb|AAB38005.1| putative outer membrane protein [Borre...    33   2.9
gi|23478426|gb|EAA15516.1| hypothetical protein [Plasmodium yoel...    33   2.9
gi|127336|sp|P13828|MSP1_PLAYO Merozoite surface protein 1 precu...    33   2.9
gi|281081|pir||A44048 genome polyprotein - Vilyuisk virus (strai...    33   2.9
gi|13785811|gb|AAK39513.1| pericentriolar material gene 1 protei...    33   2.9
gi|22036364|gb|AAM89602.1| IpaD [Shigella dysenteriae]                 33   2.9
gi|22036356|gb|AAM89598.1| IpaD [Shigella flexneri]                    33   2.9
gi|22036374|gb|AAM89607.1| IpaD [Shigella dysenteriae]                 33   2.9
gi|310908|gb|AAA47931.1| polyprotein                                   33   2.9
gi|31418561|gb|AAH53060.1| Vav2 protein [Mus musculus]                 33   2.9
gi|32172777|gb|AAH53728.1| Pcm1 protein [Mus musculus]                 33   2.9
gi|1237417|gb|AAA93172.1| polyprotein precursor >gnl|BL_ORD_ID|4...    33   2.9
gi|16804929|ref|NP_472958.1| hypothetical protein [Plasmodium fa...    33   2.9
gi|28211515|ref|NP_782459.1| methyl-accepting chemotaxis protein...    33   2.9
gi|27370653|gb|AAH37641.1| Golga4 protein [Mus musculus]               33   2.9
gi|6678555|ref|NP_033526.1| Vav2 oncogene [Mus musculus] >gnl|BL...    33   2.9
gi|23487564|gb|EAA21085.1| hypothetical protein [Plasmodium yoel...    33   2.9
gi|1236797|gb|AAA93011.1| polyprotein precursor                        33   2.9
gi|1237423|gb|AAA93176.1| polyprotein precursor                        33   2.9
gi|19075784|ref|NP_588284.1| putative coiled-coil protein [Schiz...    33   2.9
gi|644877|gb|AAA62147.1| polyprotein                                   33   2.9
gi|23510054|ref|NP_702720.1| hypothetical protein [Plasmodium fa...    33   2.9
gi|130524|sp|P13899|POLG_TMEVD Genome polyprotein [Contains: Coa...    33   2.9
gi|130525|sp|P08545|POLG_TMEVG Genome polyprotein [Contains: Coa...    33   2.9
gi|9626124|ref|NP_040350.1| viral polyprotein [Theilovirus] >gnl...    33   2.9
gi|74455|pir||GNNYTP genome polyprotein - murine poliovirus (str...    33   2.9
gi|34853146|ref|XP_216030.2| similar to Vav2 gene product [Rattu...    33   2.9
gi|160082|gb|AAA29486.1| major merozoite surface antigen               33   2.9
gi|42559470|sp|Q86RN8|MYSP_BOOMI Paramyosin >gnl|BL_ORD_ID|12326...    33   3.8
gi|23508398|ref|NP_701067.1| hypothetical protein [Plasmodium fa...    33   3.8
gi|38092637|ref|XP_356564.1| similar to hypothetical protein FLJ...    33   3.8
gi|34581446|ref|ZP_00142926.1| patatin b1 precursor [Rickettsia ...    33   3.8
gi|50556840|ref|XP_505828.1| hypothetical protein [Yarrowia lipo...    33   3.8
gi|46249876|gb|AAH68827.1| LOC414564 protein [Xenopus laevis]          33   3.8
gi|130440|sp|P17593|POLG_EMCVB Genome polyprotein [Contains: Coa...    33   3.8
gi|1084012|pir||S55401 capsid polyprotein precursor - encephalom...    33   3.8
gi|19032923|gb|AAL83502.1| polyprotein [Encephalomyocarditis virus]    33   3.8
gi|74451|pir||GNNYED genome polyprotein - encephalomyocarditis v...    33   3.8
gi|1346740|sp|P17594|POLG_EMCVD Genome polyprotein [Contains: Co...    33   3.8
gi|323857|gb|AAA43035.1| polyprotein                                   33   3.8
gi|31580775|gb|AAP51180.1| polyprotein [Encephalomyocarditis virus]    33   3.8
gi|323853|gb|AAA43033.1| polyprotein region                            33   3.8
gi|46309083|emb|CAE84563.1| polyprotein [Encephalomyocarditis vi...    33   3.8
gi|38489080|gb|AAR21228.1| indolepyruvate oxidoreductase I alpha...    33   3.8
gi|50760238|ref|XP_417939.1| PREDICTED: similar to apolipoprotei...    33   3.8
gi|3913786|sp|Q42434|BIP_SPIOL Luminal binding protein precursor...    32   5.0
gi|415608|dbj|BAA03203.1| P115A [Pneumocystis carinii]                 32   5.0
gi|309823|gb|AAA33797.1| major surface glycoprotein                    32   5.0
gi|48139422|ref|XP_397005.1| similar to ENSANGP00000021165 [Apis...    32   5.0
gi|34870961|ref|XP_342907.1| similar to macrophin 1 isoform 4 [R...    32   5.0
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di...    32   5.0
gi|50423079|ref|XP_460118.1| unnamed protein product [Debaryomyc...    32   5.0
gi|39581372|emb|CAE69269.1| Hypothetical protein CBG15322 [Caeno...    32   5.0
gi|23481286|gb|EAA17609.1| rhoptry protein [Plasmodium yoelii yo...    32   5.0
gi|18310866|ref|NP_562800.1| hypothetical protein CPE1884 [Clost...    32   5.0
gi|4324942|gb|AAD17197.1| heat shock 70 protein [Entodinium caud...    32   5.0
gi|626059|pir||JC2221 major surface glycoprotein 1 - Pneumocysti...    32   5.0
gi|42733831|gb|AAS38749.1| similar to Arabidopsis thaliana (Mous...    32   5.0
gi|6911104|gb|AAF31379.1| variant erythrocyte surface antigen-1a...    32   5.0
gi|50554337|ref|XP_504577.1| hypothetical protein [Yarrowia lipo...    32   5.0
gi|32421487|ref|XP_331187.1| hypothetical protein [Neurospora cr...    32   5.0
gi|4433322|dbj|BAA21002.1| major surface antigen MSG1 [Pneumocys...    32   5.0
gi|3043467|emb|CAA06317.1| P50 adhesin [Mycoplasma hominis]            32   5.0
gi|45187836|ref|NP_984059.1| ADL037Wp [Eremothecium gossypii] >g...    32   5.0
gi|46443548|gb|EAL02829.1| hypothetical protein CaO19.9236 [Cand...    32   6.6
gi|30020048|ref|NP_831679.1| Phage-related protein [Bacteriophag...    32   6.6
gi|28211111|ref|NP_782055.1| hypothetical protein CTC01434 [Clos...    32   6.6
gi|16759005|ref|NP_454622.1| DnaK protein (heat shock protein 70...    32   6.6
gi|38233642|ref|NP_939409.1| ATP synthase B chain [Corynebacteri...    32   6.6
gi|46131743|ref|ZP_00170118.2| COG0845: Membrane-fusion protein ...    32   6.6
gi|22036354|gb|AAM89597.1| IpaD [Shigella flexneri]                    32   6.6
gi|45384404|ref|NP_990273.1| restin [Gallus gallus] >gnl|BL_ORD_...    32   6.6
gi|585277|sp|P38530|HSF2_CHICK Heat shock factor protein 2 (HSF ...    32   6.6
gi|23508612|ref|NP_701281.1| hypothetical protein [Plasmodium fa...    32   6.6
gi|50744518|ref|XP_419760.1| PREDICTED: similar to Heat shock fa...    32   6.6
gi|28375557|emb|CAD66602.1| SMC protein [Pyrococcus furiosus]          32   8.6
gi|4895067|gb|AAD32709.1| ACC protein [Entamoeba histolytica]          32   8.6
gi|28898513|ref|NP_798118.1| hypothetical protein VP1739 [Vibrio...    32   8.6
gi|50405018|ref|YP_054110.1| hypothetical protein with coiled-co...    32   8.6
gi|6094374|sp|O57594|SUR6_FUGRU Surfeit locus protein 6 homolog ...    32   8.6
gi|7484428|pir||T07189 late embryogenesis abundant protein homol...    32   8.6
gi|9801275|emb|CAC03578.1| hypothetical protein [Plasmodium berg...    32   8.6
gi|23508065|ref|NP_700735.1| hypothetical protein [Plasmodium fa...    32   8.6
gi|16763402|ref|NP_459017.1| chaperone Hsp70 [Salmonella typhimu...    32   8.6
gi|21262188|gb|AAM44457.1| CTCL tumor antigen HD-CL-01 [Homo sap...    32   8.6
gi|49481763|ref|YP_037329.1| surface protein, LPXTG-motif cell w...    32   8.6
gi|46431856|gb|EAK91379.1| hypothetical protein CaO19.7818 [Cand...    32   8.6
gi|40674454|gb|AAH65022.1| PCM1 protein [Homo sapiens]                 32   8.6
gi|29653386|ref|NP_819078.1| hypothetical protein CBU0022 [Coxie...    32   8.6
gi|34534716|dbj|BAC87089.1| unnamed protein product [Homo sapiens]     32   8.6
gi|6678643|ref|NP_032499.1| keratin complex 2, basic, gene 1 [Mu...    32   8.6
gi|42527931|ref|NP_973029.1| bacteriocin ABC transporter, bacter...    32   8.6
gi|38109034|gb|EAA54961.1| hypothetical protein MG05752.4 [Magna...    32   8.6
gi|50289503|ref|XP_447183.1| unnamed protein product [Candida gl...    32   8.6
gi|2120479|pir||I40287 outer surface protein F - Lyme disease sp...    32   8.6
gi|50365233|ref|YP_053658.1| hsp70 chaperone [Mesoplasma florum ...    32   8.6
gi|25149118|ref|NP_494776.2| putative nuclear protein, with a co...    32   8.6
gi|18978215|ref|NP_579572.1| chromosome segregation protein smc ...    32   8.6
gi|34878591|ref|XP_344525.1| pericentriolar material 1 [Rattus n...    32   8.6
gi|23480430|gb|EAA16991.1| hypothetical protein [Plasmodium yoel...    32   8.6
gi|32879819|gb|AAP88740.1| pericentriolar material 1 [synthetic ...    32   8.6
gi|23478518|gb|EAA15583.1| hypothetical protein [Plasmodium yoel...    32   8.6
gi|27380861|ref|NP_772390.1| alanyl-tRNA synthetase [Bradyrhizob...    32   8.6
gi|28478967|ref|XP_129746.2| RIKEN cDNA 4930511H11 [Mus musculus]      32   8.6
gi|26325957|dbj|BAC26722.1| unnamed protein product [Mus musculus]     32   8.6
gi|31874020|emb|CAD97928.1| hypothetical protein [Homo sapiens]        32   8.6
gi|19568856|gb|AAL91941.1| signal recognition particle signal se...    32   8.6
gi|36031016|ref|NP_060487.2| CTCL tumor antigen L14-2 [Homo sapi...    32   8.6
gi|23485824|gb|EAA20589.1| Formin Homology 2 Domain, putative [P...    32   8.6
gi|30348701|emb|CAD90000.1| hypothetical protein [Homo sapiens]        32   8.6
gi|4454113|emb|CAA77159.1| A-type inclusion protein [Cowpox virus]     32   8.6
gi|21740028|emb|CAD39031.1| hypothetical protein [Homo sapiens]        32   8.6
gi|42659829|ref|XP_370616.2| similar to hypothetical protein [Ho...    32   8.6
gi|71537|pir||KRMS2 keratin, type II cytoskeletal - mouse (fragm...    32   8.6
gi|39590066|emb|CAE61064.1| Hypothetical protein CBG04813 [Caeno...    32   8.6
gi|37181897|gb|AAQ88752.1| KFSP2566 [Homo sapiens]                     32   8.6
gi|12653367|gb|AAH00453.1| PCM1 protein [Homo sapiens]                 32   8.6


>gi|17544496|ref|NP_501579.1| microfilariae surface-associated
           protein like (4J855) [Caenorhabditis elegans]
 gi|7510739|pir||T27552 hypothetical protein ZC410.5 -
           Caenorhabditis elegans
 gi|3881384|emb|CAA92570.1| Hypothetical protein ZC410.5a
           [Caenorhabditis elegans]
          Length = 174

 Score =  285 bits (729), Expect = 3e-76
 Identities = 147/174 (84%), Positives = 147/174 (84%)
 Frame = +1

Query: 1   MEGEISSQSVAMFGRXXXXXXXXXXXXHAGFFDDVQGVTSDVGNFFSNQFQNAKDLFSND 180
           MEGEISSQSVAMFGR            HAGFFDDVQGVTSDVGNFFSNQFQNAKDLFSND
Sbjct: 1   MEGEISSQSVAMFGRVSAVLLLLAVSAHAGFFDDVQGVTSDVGNFFSNQFQNAKDLFSND 60

Query: 181 QNELEKNVQRVKDLLTGLKEKVKGLEPLANDAQKETLKKVDGFLAEVSSFQSEVKEEGSA 360
           QNELEKNVQRVKDLLTGLKEKVKGLEPLANDAQKETLKKVDGFLAEVSSFQSEVKEEGSA
Sbjct: 61  QNELEKNVQRVKDLLTGLKEKVKGLEPLANDAQKETLKKVDGFLAEVSSFQSEVKEEGSA 120

Query: 361 KFEENKVKWQNMVTEMFDKSGLNNVLKLVGMQNXXXXXXXXXXXXXXXYMIFVR 522
           KFEENKVKWQNMVTEMFDKSGLNNVLKLVGMQN               YMIFVR
Sbjct: 121 KFEENKVKWQNMVTEMFDKSGLNNVLKLVGMQNSAPSAFISAAFAPIFYMIFVR 174




[DB home][top]