Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= ZC410_6
         (930 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|13548492|emb|CAC35869.1| C. elegans LPL-1 protein (correspond...   604   e-171
gi|38422753|emb|CAE54911.1| C. elegans LPL-1 protein (correspond...   595   e-169
gi|32565879|ref|NP_501580.2| LiPoate Ligase (27.4 kD) (lpl-1) [C...   395   e-109
gi|39586445|emb|CAE74104.1| Hypothetical protein CBG21764 [Caeno...   317   3e-85
gi|13548493|emb|CAA92571.2| C. elegans LPL-1 protein (correspond...   200   3e-50
gi|7510741|pir||T27553 hypothetical protein ZC410.7 - Caenorhabd...   200   3e-50
gi|21355483|ref|NP_649472.1| CG9804-PA [Drosophila melanogaster]...   175   1e-42
gi|39586446|emb|CAE74105.1| Hypothetical protein CBG21765 [Caeno...   172   1e-41
gi|47216500|emb|CAG02151.1| unnamed protein product [Tetraodon n...   155   9e-37
gi|31203215|ref|XP_310556.1| ENSANGP00000017330 [Anopheles gambi...   153   6e-36
gi|13385514|ref|NP_080286.1| RIKEN cDNA 2610209A20 [Mus musculus...   138   2e-31
gi|12843396|dbj|BAB25967.1| unnamed protein product [Mus musculus]    138   2e-31
gi|34859454|ref|XP_344925.1| similar to RIKEN cDNA 2610209A20 [R...   136   8e-31
gi|3122357|sp|O23021|LIPB_ARATH Probable lipoate-protein ligase ...   116   6e-25
gi|15219770|ref|NP_171958.1| biotin/lipoate A/B protein ligase f...   116   6e-25
gi|46200048|ref|YP_005715.1| lipoate-protein ligase B [Thermus t...   113   7e-24
gi|50875186|emb|CAG35026.1| probable lipoate-protein ligase B (L...   113   7e-24
gi|19115660|ref|NP_594748.1| putative lipoate-protein ligase B [...   112   9e-24
gi|48836746|ref|ZP_00293742.1| COG0321: Lipoate-protein ligase B...   112   1e-23
gi|46105974|ref|ZP_00199769.1| COG0321: Lipoate-protein ligase B...   112   2e-23
gi|38234215|ref|NP_939982.1| lipoate-protein ligase B [Corynebac...   109   8e-23
gi|28572458|ref|NP_789238.1| lipoate-protein ligase B [Tropherym...   108   2e-22
gi|25028655|ref|NP_738709.1| putative lipoate-protein ligase B [...   108   2e-22
gi|29336718|sp|Q8FNP5|LIPB_COREF Lipoyltransferase (Lipoyl-[acyl...   108   2e-22
gi|28493430|ref|NP_787591.1| lipoate-protein ligase B [Tropherym...   108   2e-22
gi|46363793|ref|ZP_00226491.1| COG0321: Lipoate-protein ligase B...   107   4e-22
gi|20808099|ref|NP_623270.1| Lipoate-protein ligase B [Thermoana...   107   4e-22
gi|15827384|ref|NP_301647.1| putative lipoate-protein ligase B [...   103   4e-21
gi|6685619|sp|Q9X6X4|LIPB_MYXXA Lipoyltransferase (Lipoyl-[acyl-...   102   1e-20
gi|19553409|ref|NP_601411.1| lipoate-protein ligase B [Corynebac...   100   5e-20
gi|48894163|ref|ZP_00327361.1| COG0321: Lipoate-protein ligase B...   100   5e-20
gi|15841708|ref|NP_336745.1| lipoate-protein ligase B [Mycobacte...   100   8e-20
gi|31793396|ref|NP_855889.1| Probable lipoate biosynthesis prote...   100   8e-20
gi|15609354|ref|NP_216733.1| lipB [Mycobacterium tuberculosis H3...   100   8e-20
gi|48855899|ref|ZP_00310057.1| COG0321: Lipoate-protein ligase B...    99   1e-19
gi|16331217|ref|NP_441945.1| LipB protein [Synechocystis sp. PCC...    98   2e-19
gi|32141160|ref|NP_733562.1| putative lipoate-protein ligase [St...    98   3e-19
gi|18417727|ref|NP_567866.1| lipoyltransferase (LIP2p) [Arabidop...    97   3e-19
gi|39997529|ref|NP_953480.1| lipoate-protein ligase B [Geobacter...    97   5e-19
gi|41408056|ref|NP_960892.1| LipB [Mycobacterium avium subsp. pa...    96   9e-19
gi|50288599|ref|XP_446729.1| unnamed protein product [Candida gl...    96   1e-18
gi|49080930|ref|XP_403928.1| hypothetical protein UM06313.1 [Ust...    95   2e-18
gi|22298375|ref|NP_681622.1| lipoate-protein ligase [Thermosynec...    95   3e-18
gi|37523983|ref|NP_927360.1| lipoate-protein ligase B [Gloeobact...    94   4e-18
gi|46120087|ref|ZP_00179412.2| COG0321: Lipoate-protein ligase B...    94   6e-18
gi|50842180|ref|YP_055407.1| lipoate-protein ligase B [Propionib...    94   6e-18
gi|15893280|ref|NP_360994.1| probable lipoate-protein ligase B [...    94   6e-18
gi|34581054|ref|ZP_00142534.1| probable lipoate-protein ligase B...    94   6e-18
gi|25405224|pir||D96516 F16N3.14 [imported] - Arabidopsis thalia...    93   7e-18
gi|42454386|ref|ZP_00154293.1| hypothetical protein Rick128801 [...    93   7e-18
gi|23125051|ref|ZP_00107002.1| COG0321: Lipoate-protein ligase B...    93   1e-17
gi|37525259|ref|NP_928603.1| lipoate-protein ligase B (lipoate b...    92   2e-17
gi|29346499|ref|NP_810002.1| lipoate-protein ligase B [Bacteroid...    92   2e-17
gi|48844511|ref|ZP_00298818.1| COG0321: Lipoate-protein ligase B...    91   3e-17
gi|15604705|ref|NP_221223.1| PROBABLE LIPOATE-PROTEIN LIGASE B (...    91   3e-17
gi|50120237|ref|YP_049404.1| lipoate-protein ligase B [Erwinia c...    89   1e-16
gi|48478332|ref|YP_024038.1| lipoate-protein ligase B [Picrophil...    89   1e-16
gi|15677090|ref|NP_274242.1| lipoate-protein ligase B [Neisseria...    89   2e-16
gi|13626575|sp|Q9JZA4|LIPB_NEIMB Lipoyltransferase (Lipoyl-[acyl...    89   2e-16
gi|45915773|ref|ZP_00197220.1| COG0321: Lipoate-protein ligase B...    88   2e-16
gi|29654567|ref|NP_820259.1| lipoate-protein ligase B [Coxiella ...    88   2e-16
gi|48863957|ref|ZP_00317850.1| COG0321: Lipoate-protein ligase B...    88   3e-16
gi|15794300|ref|NP_284122.1| putative lipoate-protein ligase B [...    88   3e-16
gi|12644537|sp|Q9JUC7|LIPB_NEIMA Lipoyltransferase (Lipoyl-[acyl...    88   3e-16
gi|50257015|gb|EAL19733.1| hypothetical protein CNBG3610 [Crypto...    87   4e-16
gi|30249459|ref|NP_841529.1| lipB: lipoate-protein ligase B [Nit...    87   4e-16
gi|22971103|ref|ZP_00018096.1| hypothetical protein [Chloroflexu...    87   4e-16
gi|46579319|ref|YP_010127.1| lipoate-protein ligase B [Desulfovi...    87   4e-16
gi|45513768|ref|ZP_00165334.1| COG0321: Lipoate-protein ligase B...    87   4e-16
gi|17230677|ref|NP_487225.1| lipoate-protein ligase B [Nostoc sp...    87   4e-16
gi|30577832|emb|CAD90963.1| LssX protein [Legionella pneumophila]      87   5e-16
gi|16122812|ref|NP_406125.1| lipoate-protein ligase B [Yersinia ...    87   5e-16
gi|29832553|ref|NP_827187.1| putative lipoate-protein ligase [St...    87   5e-16
gi|34541031|ref|NP_905510.1| lipoate-protein ligase B [Porphyrom...    87   7e-16
gi|50557070|ref|XP_505943.1| hypothetical protein [Yarrowia lipo...    87   7e-16
gi|27380368|ref|NP_771897.1| lipoate biosynthesis protein B [Bra...    86   9e-16
gi|30577823|emb|CAD90955.1| LssX protein [Legionella pneumophila]      86   2e-15
gi|46141154|ref|ZP_00203879.1| COG0321: Lipoate-protein ligase B...    86   2e-15
gi|15616879|ref|NP_240092.1| lipoate-protein ligase B [Buchnera ...    86   2e-15
gi|23470793|ref|ZP_00126125.1| COG0321: Lipoate-protein ligase B...    85   2e-15
gi|18313493|ref|NP_560160.1| lipoate protein ligase B [Pyrobacul...    85   2e-15
gi|48833368|ref|ZP_00290388.1| COG0321: Lipoate-protein ligase B...    85   3e-15
gi|23473966|ref|ZP_00129261.1| COG0321: Lipoate-protein ligase B...    85   3e-15
gi|42520825|ref|NP_966740.1| lipoate-protein ligase B [Wolbachia...    85   3e-15
gi|6323268|ref|NP_013340.1| Lipoyl ligase, involved in the modif...    84   3e-15
gi|46914459|emb|CAG21238.1| putative lipoate-protein ligase B [P...    84   4e-15
gi|46202008|ref|ZP_00053966.2| COG0321: Lipoate-protein ligase B...    84   4e-15
gi|46193595|ref|ZP_00207753.1| COG0321: Lipoate-protein ligase B...    84   4e-15
gi|16126415|ref|NP_420979.1| lipoate-protein ligase B [Caulobact...    84   4e-15
gi|21241438|ref|NP_641020.1| lipoate biosynthesis protein B [Xan...    84   4e-15
gi|15888875|ref|NP_354556.1| AGR_C_2865p [Agrobacterium tumefaci...    84   6e-15
gi|17935454|ref|NP_532244.1| lipoate biosynthesis protein B [Agr...    84   6e-15
gi|39936232|ref|NP_948508.1| lipoate biosynthesis protein B [Rho...    84   6e-15
gi|48477617|ref|YP_023323.1| lipoate-protein ligase B [Picrophil...    83   1e-14
gi|28871934|ref|NP_794553.1| lipoate-protein ligase B [Pseudomon...    83   1e-14
gi|24112070|ref|NP_706580.1| lipoate-protein ligase B (lipoate b...    83   1e-14
gi|45200990|ref|NP_986560.1| AGL107Wp [Eremothecium gossypii] >g...    83   1e-14
gi|30062181|ref|NP_836352.1| lipoate biosynthesis protein LipB [...    82   1e-14
gi|45522005|ref|ZP_00173521.1| COG0321: Lipoate-protein ligase B...    82   1e-14
gi|23106483|ref|ZP_00092937.1| COG0321: Lipoate-protein ligase B...    82   1e-14
gi|50307799|ref|XP_453893.1| LIPB_KLULA [Kluyveromyces lactis] >...    82   1e-14
gi|17989023|ref|NP_541656.1| LIPOATE-PROTEIN LIGASE B [Brucella ...    82   2e-14
gi|48728983|ref|ZP_00262736.1| COG0321: Lipoate-protein ligase B...    82   2e-14
gi|146622|gb|AAA66342.1| LIPB protein                                  82   2e-14
gi|15800344|ref|NP_286356.1| lipoate biosynthesis protein B [Esc...    82   2e-14
gi|21232881|ref|NP_638798.1| lipoate biosynthesis protein B [Xan...    82   2e-14
gi|26246610|ref|NP_752650.1| Lipoate-protein ligase B [Escherich...    82   2e-14
gi|33865202|ref|NP_896761.1| putative lipoate-protein ligase B [...    82   2e-14
gi|34498551|ref|NP_902766.1| lipoate-protein ligase B [Chromobac...    82   2e-14
gi|48850335|ref|ZP_00304577.1| COG0321: Lipoate-protein ligase B...    81   3e-14
gi|16759594|ref|NP_455211.1| lipoate-protein ligase B (lipoate b...    81   3e-14
gi|16419147|gb|AAL19586.1| putative ligase in lipoate biosynthes...    81   3e-14
gi|39546300|ref|NP_459627.2| putative ligase [Salmonella typhimu...    81   3e-14
gi|30173099|sp|Q8Z8I2|LIPB_SALTI Lipoyltransferase (Lipoyl-[acyl...    81   3e-14
gi|46443146|gb|EAL02430.1| hypothetical protein CaO19.10528 [Can...    81   4e-14
gi|21623162|gb|AAM67816.1| lipoate-protein ligase B [Buchnera ap...    80   6e-14
gi|30410818|ref|NP_660605.2| lipoate-protein ligase B [Buchnera ...    80   6e-14
gi|33860958|ref|NP_892519.1| putative lipoate-protein ligase B [...    80   8e-14
gi|23500333|ref|NP_699773.1| lipoate-protein ligase B [Brucella ...    80   8e-14
gi|13471382|ref|NP_102948.1| lipoate biosynthesis protein B [Mes...    80   8e-14
gi|15965149|ref|NP_385502.1| PROBABLE LIPOATE-PROTEIN LIGASE B [...    79   1e-13
gi|3122378|sp|Q00520|LIPB_PARVE Lipoyltransferase (Lipoyl-[acyl-...    79   1e-13
gi|46133661|ref|ZP_00157534.2| COG0321: Lipoate-protein ligase B...    79   1e-13
gi|33862487|ref|NP_894047.1| putative lipoate-protein ligase B [...    79   1e-13
gi|50427239|ref|XP_462232.1| unnamed protein product [Debaryomyc...    79   1e-13
gi|33239850|ref|NP_874792.1| Lipoate-protein ligase B [Prochloro...    79   1e-13
gi|33152980|ref|NP_874333.1| lipoate-protein ligase B; lipoate b...    79   1e-13
gi|24372745|ref|NP_716787.1| lipoate-protein ligase B [Shewanell...    79   1e-13
gi|48764417|ref|ZP_00268969.1| COG0321: Lipoate-protein ligase B...    79   2e-13
gi|16272002|ref|NP_438200.1| lipoate biosynthesis protein B [Hae...    79   2e-13
gi|48868744|ref|ZP_00322043.1| COG0321: Lipoate-protein ligase B...    78   2e-13
gi|46315355|ref|ZP_00215938.1| COG0321: Lipoate-protein ligase B...    78   2e-13
gi|49474259|ref|YP_032301.1| Lipoate biosynthesis protein B [Bar...    78   2e-13
gi|46320805|ref|ZP_00221189.1| COG0321: Lipoate-protein ligase B...    78   3e-13
gi|37679085|ref|NP_933694.1| lipoate-protein ligase B [Vibrio vu...    78   3e-13
gi|27363761|ref|NP_759289.1| Lipoate-protein ligase B [Vibrio vu...    78   3e-13
gi|49094914|ref|XP_408918.1| hypothetical protein AN4781.2 [Aspe...    78   3e-13
gi|15220259|ref|NP_175189.1| lipoyltransferase, putative [Arabid...    78   3e-13
gi|4887209|gb|AAD32236.1| lipoate biosynthesis protein B [Pseudo...    77   4e-13
gi|15599192|ref|NP_252686.1| lipoate-protein ligase B [Pseudomon...    77   4e-13
gi|46308766|ref|ZP_00210958.1| COG0321: Lipoate-protein ligase B...    77   5e-13
gi|32490924|ref|NP_871178.1| lipB [Wigglesworthia glossinidia en...    77   7e-13
gi|28897491|ref|NP_797096.1| lipoate-protein ligase B [Vibrio pa...    76   9e-13
gi|33860176|sp|Q9KTF8|LIPB_VIBCH Lipoyltransferase (Lipoyl-[acyl...    76   9e-13
gi|15640960|ref|NP_230591.1| lipoate-protein ligase B [Vibrio ch...    76   9e-13
gi|22996342|ref|ZP_00040602.1| COG0321: Lipoate-protein ligase B...    76   9e-13
gi|17545042|ref|NP_518444.1| PROBABLE LIPOATE-PROTEIN LIGASE B [...    76   9e-13
gi|26991481|ref|NP_746906.1| lipoate-protein ligase B [Pseudomon...    75   2e-12
gi|41149548|ref|XP_370636.1| similar to RIKEN cDNA 2610209A20 [H...    75   2e-12
gi|15805790|ref|NP_294488.1| lipoate-protein ligase B [Deinococc...    75   3e-12
gi|50085954|ref|YP_047464.1| lipoate-protein ligase B (Lipoate b...    74   4e-12
gi|15837871|ref|NP_298559.1| lipoate biosynthesis protein B [Xyl...    74   4e-12
gi|49475555|ref|YP_033596.1| Lipoate biosynthesis protein B [Bar...    74   4e-12
gi|32029461|ref|ZP_00132484.1| COG0321: Lipoate-protein ligase B...    74   5e-12
gi|48786413|ref|ZP_00282547.1| COG0321: Lipoate-protein ligase B...    74   5e-12
gi|23466581|ref|ZP_00122169.1| COG0321: Lipoate-protein ligase B...    74   5e-12
gi|47573862|ref|ZP_00243899.1| COG0321: Lipoate-protein ligase B...    74   5e-12
gi|49088878|gb|AAT51616.1| PA3997 [synthetic construct]                74   6e-12
gi|22994243|ref|ZP_00038754.1| COG0321: Lipoate-protein ligase B...    74   6e-12
gi|33599162|ref|NP_886722.1| lipoate-protein ligase B [Bordetell...    73   8e-12
gi|33594887|ref|NP_882530.1| lipoate-protein ligase B [Bordetell...    73   8e-12
gi|33591364|ref|NP_879008.1| lipoate-protein ligase B [Bordetell...    72   1e-11
gi|46128631|ref|XP_388869.1| hypothetical protein FG08693.1 [Gib...    72   1e-11
gi|15603794|ref|NP_246868.1| LipB [Pasteurella multocida Pm70] >...    71   3e-11
gi|48770544|ref|ZP_00274887.1| COG0321: Lipoate-protein ligase B...    71   3e-11
gi|50731411|ref|XP_425665.1| PREDICTED: similar to RIKEN cDNA 26...    71   4e-11
gi|27904745|ref|NP_777871.1| lipoate-protein ligase B [Buchnera ...    70   5e-11
gi|45515867|ref|ZP_00167421.1| COG0321: Lipoate-protein ligase B...    70   9e-11
gi|48851787|ref|ZP_00305984.1| COG0321: Lipoate-protein ligase B...    68   3e-10
gi|45657920|ref|YP_002006.1| lipoate protein ligase B [Leptospir...    68   3e-10
gi|24214431|ref|NP_711912.1| Lipoate-protein ligase B [Leptospir...    68   3e-10
gi|48852369|ref|ZP_00306556.1| COG0321: Lipoate-protein ligase B...    68   3e-10
gi|42522348|ref|NP_967728.1| lipB [Bdellovibrio bacteriovorus HD...    67   7e-10
gi|11465539|ref|NP_045070.1| lipoate biosynthesis protein B [Cya...    64   5e-09
gi|6685613|sp|O75627|LIPX_HUMAN Very potential lipoate-protein l...    59   1e-07
gi|25407705|pir||F85363 hypothetical protein AT4g31050 [imported...    56   1e-06
gi|3122366|sp|Q51854|LIPB_PROHO Lipoyltransferase (Lipoyl-[acyl-...    55   2e-06
gi|38103000|gb|EAA49765.1| hypothetical protein MG09756.4 [Magna...    54   5e-06
gi|46204230|ref|ZP_00050298.2| COG0321: Lipoate-protein ligase B...    51   4e-05
gi|27680577|ref|XP_213981.1| similar to mitochondrial ribosomal ...    49   2e-04
gi|25407707|pir||G85363 hypothetical protein AT4g31060 [imported...    48   3e-04
gi|31214682|ref|XP_315880.1| ENSANGP00000017500 [Anopheles gambi...    48   4e-04
gi|45478214|gb|AAS66278.1| LRRGT00187 [Rattus norvegicus]              48   4e-04
gi|26667174|ref|NP_751918.1| mitochondrial ribosomal protein L42...    47   5e-04
gi|7662637|ref|NP_054769.1| mitochondrial ribosomal protein L42 ...    47   5e-04
gi|7106798|gb|AAF36124.1| HSPC204 [Homo sapiens]                       47   6e-04
gi|23115673|ref|ZP_00100624.1| COG0321: Lipoate-protein ligase B...    47   6e-04
gi|34865484|ref|XP_345957.1| similar to RIKEN cDNA 2900055D03 [R...    47   6e-04
gi|13385564|ref|NP_080341.1| RIKEN cDNA 2900055D03 [Mus musculus...    47   8e-04
gi|17647695|ref|NP_523673.1| CG12921-PA [Drosophila melanogaster...    45   0.002
gi|27718065|ref|XP_216882.1| similar to RIKEN cDNA 2900055D03 [R...    45   0.002
gi|50728484|ref|XP_416141.1| PREDICTED: similar to Mitochondrial...    44   0.004
gi|32408589|ref|XP_324776.1| hypothetical protein [Neurospora cr...    42   0.015
gi|20862296|ref|XP_122057.1| similar to RIKEN cDNA 2900055D03 [M...    42   0.015
gi|15811150|gb|AAL08828.1| hypothetical lipoate-protein ligase B...    42   0.025
gi|23612779|ref|NP_704318.1| lipoate-protein ligase, putative [P...    41   0.033
gi|23479584|gb|EAA16374.1| putative ligase in lipoate biosynthes...    40   0.074
gi|47222044|emb|CAG12070.1| unnamed protein product [Tetraodon n...    35   1.8
gi|30468086|ref|NP_848973.1| lipoate-protein ligase B [Cyanidios...    35   2.4
gi|28870896|ref|NP_793515.1| sigma-54 dependent transcriptional ...    35   3.1
gi|45508699|ref|ZP_00161036.1| COG0321: Lipoate-protein ligase B...    35   3.1
gi|38348256|ref|NP_940870.1| FLJ46180 protein [Homo sapiens] >gn...    34   5.3
gi|47572664|ref|ZP_00242706.1| COG5295: Autotransporter adhesin ...    34   5.3
gi|46318548|ref|ZP_00218993.1| COG2971: Predicted N-acetylglucos...    33   6.9
gi|38077408|ref|XP_357334.1| similar to Glycerol-3-phosphate acy...    33   6.9
gi|50760351|ref|XP_417983.1| PREDICTED: similar to complement C3...    33   6.9
gi|23508256|ref|NP_700925.1| hypothetical protein [Plasmodium fa...    33   6.9
gi|26788078|emb|CAD58751.1| SI:dZ172E19.1 (novel protein) [Danio...    33   9.1


>gi|13548492|emb|CAC35869.1| C. elegans LPL-1 protein (corresponding
           sequence ZC410.7b) [Caenorhabditis elegans]
          Length = 309

 Score =  604 bits (1557), Expect = e-171
 Identities = 298/309 (96%), Positives = 298/309 (96%)
 Frame = -1

Query: 930 MLRNLFSITYRFASSDSPRKVVVCANGTIAAWHPPQHFPYEHTKPIDLGSLTKKDQXXXX 751
           MLRNLFSITYRFASSDSPRKVVVCANGTIAAWHPPQHFPYEHTKPIDLGSLTKKDQ
Sbjct: 1   MLRNLFSITYRFASSDSPRKVVVCANGTIAAWHPPQHFPYEHTKPIDLGSLTKKDQSSRL 60

Query: 750 XXXXXXXSIPREPVNAELKDIFYTSKHEWYSRTREERLRNVAAPIPRHLVKANKSETHSL 571
                  SIPREPVNAELKDIFYTSKHEWYSRTREERLRNVAAPIPRHLVKANKSETHSL
Sbjct: 61  SAAAKASSIPREPVNAELKDIFYTSKHEWYSRTREERLRNVAAPIPRHLVKANKSETHSL 120

Query: 570 NFILALEHTPVYTVGIRSKGYTKEEETRLMRLGAEFHRTSRGGLITFHGPGQLVLYPICD 391
           NFILALEHTPVYTVGIRSKGYTKEEETRLMRLGAEFHRTSRGGLITFHGPGQLVLYPICD
Sbjct: 121 NFILALEHTPVYTVGIRSKGYTKEEETRLMRLGAEFHRTSRGGLITFHGPGQLVLYPICD 180

Query: 390 VRRISIKQLDAATEGFGIKNVGRTANTGVWVSNERKLAAIGIAVSGGVSYHGIAINCNTD 211
           VRRISIKQLDAATEGFGIKNVGRTANTGVWVSNERKLAAIGIAVSGGVSYHGIAINCNTD
Sbjct: 181 VRRISIKQLDAATEGFGIKNVGRTANTGVWVSNERKLAAIGIAVSGGVSYHGIAINCNTD 240

Query: 210 LRWFDNIVGCGIEGVSTTSLSQETSRNVTVSDARPILLNAFANNFECLLNEPNDYSTCSN 31
           LRWFDNIVGCGIEGVSTTSLSQETSRNVTVSDARPILLNAFANNFECLLNEPNDYSTCSN
Sbjct: 241 LRWFDNIVGCGIEGVSTTSLSQETSRNVTVSDARPILLNAFANNFECLLNEPNDYSTCSN 300

Query: 30  LKITNVVSS 4
           LKITNVVSS
Sbjct: 301 LKITNVVSS 309




[DB home][top]