Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZC410_6
(930 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|13548492|emb|CAC35869.1| C. elegans LPL-1 protein (correspond... 604 e-171
gi|38422753|emb|CAE54911.1| C. elegans LPL-1 protein (correspond... 595 e-169
gi|32565879|ref|NP_501580.2| LiPoate Ligase (27.4 kD) (lpl-1) [C... 395 e-109
gi|39586445|emb|CAE74104.1| Hypothetical protein CBG21764 [Caeno... 317 3e-85
gi|13548493|emb|CAA92571.2| C. elegans LPL-1 protein (correspond... 200 3e-50
gi|7510741|pir||T27553 hypothetical protein ZC410.7 - Caenorhabd... 200 3e-50
gi|21355483|ref|NP_649472.1| CG9804-PA [Drosophila melanogaster]... 175 1e-42
gi|39586446|emb|CAE74105.1| Hypothetical protein CBG21765 [Caeno... 172 1e-41
gi|47216500|emb|CAG02151.1| unnamed protein product [Tetraodon n... 155 9e-37
gi|31203215|ref|XP_310556.1| ENSANGP00000017330 [Anopheles gambi... 153 6e-36
gi|13385514|ref|NP_080286.1| RIKEN cDNA 2610209A20 [Mus musculus... 138 2e-31
gi|12843396|dbj|BAB25967.1| unnamed protein product [Mus musculus] 138 2e-31
gi|34859454|ref|XP_344925.1| similar to RIKEN cDNA 2610209A20 [R... 136 8e-31
gi|3122357|sp|O23021|LIPB_ARATH Probable lipoate-protein ligase ... 116 6e-25
gi|15219770|ref|NP_171958.1| biotin/lipoate A/B protein ligase f... 116 6e-25
gi|46200048|ref|YP_005715.1| lipoate-protein ligase B [Thermus t... 113 7e-24
gi|50875186|emb|CAG35026.1| probable lipoate-protein ligase B (L... 113 7e-24
gi|19115660|ref|NP_594748.1| putative lipoate-protein ligase B [... 112 9e-24
gi|48836746|ref|ZP_00293742.1| COG0321: Lipoate-protein ligase B... 112 1e-23
gi|46105974|ref|ZP_00199769.1| COG0321: Lipoate-protein ligase B... 112 2e-23
gi|38234215|ref|NP_939982.1| lipoate-protein ligase B [Corynebac... 109 8e-23
gi|28572458|ref|NP_789238.1| lipoate-protein ligase B [Tropherym... 108 2e-22
gi|25028655|ref|NP_738709.1| putative lipoate-protein ligase B [... 108 2e-22
gi|29336718|sp|Q8FNP5|LIPB_COREF Lipoyltransferase (Lipoyl-[acyl... 108 2e-22
gi|28493430|ref|NP_787591.1| lipoate-protein ligase B [Tropherym... 108 2e-22
gi|46363793|ref|ZP_00226491.1| COG0321: Lipoate-protein ligase B... 107 4e-22
gi|20808099|ref|NP_623270.1| Lipoate-protein ligase B [Thermoana... 107 4e-22
gi|15827384|ref|NP_301647.1| putative lipoate-protein ligase B [... 103 4e-21
gi|6685619|sp|Q9X6X4|LIPB_MYXXA Lipoyltransferase (Lipoyl-[acyl-... 102 1e-20
gi|19553409|ref|NP_601411.1| lipoate-protein ligase B [Corynebac... 100 5e-20
gi|48894163|ref|ZP_00327361.1| COG0321: Lipoate-protein ligase B... 100 5e-20
gi|15841708|ref|NP_336745.1| lipoate-protein ligase B [Mycobacte... 100 8e-20
gi|31793396|ref|NP_855889.1| Probable lipoate biosynthesis prote... 100 8e-20
gi|15609354|ref|NP_216733.1| lipB [Mycobacterium tuberculosis H3... 100 8e-20
gi|48855899|ref|ZP_00310057.1| COG0321: Lipoate-protein ligase B... 99 1e-19
gi|16331217|ref|NP_441945.1| LipB protein [Synechocystis sp. PCC... 98 2e-19
gi|32141160|ref|NP_733562.1| putative lipoate-protein ligase [St... 98 3e-19
gi|18417727|ref|NP_567866.1| lipoyltransferase (LIP2p) [Arabidop... 97 3e-19
gi|39997529|ref|NP_953480.1| lipoate-protein ligase B [Geobacter... 97 5e-19
gi|41408056|ref|NP_960892.1| LipB [Mycobacterium avium subsp. pa... 96 9e-19
gi|50288599|ref|XP_446729.1| unnamed protein product [Candida gl... 96 1e-18
gi|49080930|ref|XP_403928.1| hypothetical protein UM06313.1 [Ust... 95 2e-18
gi|22298375|ref|NP_681622.1| lipoate-protein ligase [Thermosynec... 95 3e-18
gi|37523983|ref|NP_927360.1| lipoate-protein ligase B [Gloeobact... 94 4e-18
gi|46120087|ref|ZP_00179412.2| COG0321: Lipoate-protein ligase B... 94 6e-18
gi|50842180|ref|YP_055407.1| lipoate-protein ligase B [Propionib... 94 6e-18
gi|15893280|ref|NP_360994.1| probable lipoate-protein ligase B [... 94 6e-18
gi|34581054|ref|ZP_00142534.1| probable lipoate-protein ligase B... 94 6e-18
gi|25405224|pir||D96516 F16N3.14 [imported] - Arabidopsis thalia... 93 7e-18
gi|42454386|ref|ZP_00154293.1| hypothetical protein Rick128801 [... 93 7e-18
gi|23125051|ref|ZP_00107002.1| COG0321: Lipoate-protein ligase B... 93 1e-17
gi|37525259|ref|NP_928603.1| lipoate-protein ligase B (lipoate b... 92 2e-17
gi|29346499|ref|NP_810002.1| lipoate-protein ligase B [Bacteroid... 92 2e-17
gi|48844511|ref|ZP_00298818.1| COG0321: Lipoate-protein ligase B... 91 3e-17
gi|15604705|ref|NP_221223.1| PROBABLE LIPOATE-PROTEIN LIGASE B (... 91 3e-17
gi|50120237|ref|YP_049404.1| lipoate-protein ligase B [Erwinia c... 89 1e-16
gi|48478332|ref|YP_024038.1| lipoate-protein ligase B [Picrophil... 89 1e-16
gi|15677090|ref|NP_274242.1| lipoate-protein ligase B [Neisseria... 89 2e-16
gi|13626575|sp|Q9JZA4|LIPB_NEIMB Lipoyltransferase (Lipoyl-[acyl... 89 2e-16
gi|45915773|ref|ZP_00197220.1| COG0321: Lipoate-protein ligase B... 88 2e-16
gi|29654567|ref|NP_820259.1| lipoate-protein ligase B [Coxiella ... 88 2e-16
gi|48863957|ref|ZP_00317850.1| COG0321: Lipoate-protein ligase B... 88 3e-16
gi|15794300|ref|NP_284122.1| putative lipoate-protein ligase B [... 88 3e-16
gi|12644537|sp|Q9JUC7|LIPB_NEIMA Lipoyltransferase (Lipoyl-[acyl... 88 3e-16
gi|50257015|gb|EAL19733.1| hypothetical protein CNBG3610 [Crypto... 87 4e-16
gi|30249459|ref|NP_841529.1| lipB: lipoate-protein ligase B [Nit... 87 4e-16
gi|22971103|ref|ZP_00018096.1| hypothetical protein [Chloroflexu... 87 4e-16
gi|46579319|ref|YP_010127.1| lipoate-protein ligase B [Desulfovi... 87 4e-16
gi|45513768|ref|ZP_00165334.1| COG0321: Lipoate-protein ligase B... 87 4e-16
gi|17230677|ref|NP_487225.1| lipoate-protein ligase B [Nostoc sp... 87 4e-16
gi|30577832|emb|CAD90963.1| LssX protein [Legionella pneumophila] 87 5e-16
gi|16122812|ref|NP_406125.1| lipoate-protein ligase B [Yersinia ... 87 5e-16
gi|29832553|ref|NP_827187.1| putative lipoate-protein ligase [St... 87 5e-16
gi|34541031|ref|NP_905510.1| lipoate-protein ligase B [Porphyrom... 87 7e-16
gi|50557070|ref|XP_505943.1| hypothetical protein [Yarrowia lipo... 87 7e-16
gi|27380368|ref|NP_771897.1| lipoate biosynthesis protein B [Bra... 86 9e-16
gi|30577823|emb|CAD90955.1| LssX protein [Legionella pneumophila] 86 2e-15
gi|46141154|ref|ZP_00203879.1| COG0321: Lipoate-protein ligase B... 86 2e-15
gi|15616879|ref|NP_240092.1| lipoate-protein ligase B [Buchnera ... 86 2e-15
gi|23470793|ref|ZP_00126125.1| COG0321: Lipoate-protein ligase B... 85 2e-15
gi|18313493|ref|NP_560160.1| lipoate protein ligase B [Pyrobacul... 85 2e-15
gi|48833368|ref|ZP_00290388.1| COG0321: Lipoate-protein ligase B... 85 3e-15
gi|23473966|ref|ZP_00129261.1| COG0321: Lipoate-protein ligase B... 85 3e-15
gi|42520825|ref|NP_966740.1| lipoate-protein ligase B [Wolbachia... 85 3e-15
gi|6323268|ref|NP_013340.1| Lipoyl ligase, involved in the modif... 84 3e-15
gi|46914459|emb|CAG21238.1| putative lipoate-protein ligase B [P... 84 4e-15
gi|46202008|ref|ZP_00053966.2| COG0321: Lipoate-protein ligase B... 84 4e-15
gi|46193595|ref|ZP_00207753.1| COG0321: Lipoate-protein ligase B... 84 4e-15
gi|16126415|ref|NP_420979.1| lipoate-protein ligase B [Caulobact... 84 4e-15
gi|21241438|ref|NP_641020.1| lipoate biosynthesis protein B [Xan... 84 4e-15
gi|15888875|ref|NP_354556.1| AGR_C_2865p [Agrobacterium tumefaci... 84 6e-15
gi|17935454|ref|NP_532244.1| lipoate biosynthesis protein B [Agr... 84 6e-15
gi|39936232|ref|NP_948508.1| lipoate biosynthesis protein B [Rho... 84 6e-15
gi|48477617|ref|YP_023323.1| lipoate-protein ligase B [Picrophil... 83 1e-14
gi|28871934|ref|NP_794553.1| lipoate-protein ligase B [Pseudomon... 83 1e-14
gi|24112070|ref|NP_706580.1| lipoate-protein ligase B (lipoate b... 83 1e-14
gi|45200990|ref|NP_986560.1| AGL107Wp [Eremothecium gossypii] >g... 83 1e-14
gi|30062181|ref|NP_836352.1| lipoate biosynthesis protein LipB [... 82 1e-14
gi|45522005|ref|ZP_00173521.1| COG0321: Lipoate-protein ligase B... 82 1e-14
gi|23106483|ref|ZP_00092937.1| COG0321: Lipoate-protein ligase B... 82 1e-14
gi|50307799|ref|XP_453893.1| LIPB_KLULA [Kluyveromyces lactis] >... 82 1e-14
gi|17989023|ref|NP_541656.1| LIPOATE-PROTEIN LIGASE B [Brucella ... 82 2e-14
gi|48728983|ref|ZP_00262736.1| COG0321: Lipoate-protein ligase B... 82 2e-14
gi|146622|gb|AAA66342.1| LIPB protein 82 2e-14
gi|15800344|ref|NP_286356.1| lipoate biosynthesis protein B [Esc... 82 2e-14
gi|21232881|ref|NP_638798.1| lipoate biosynthesis protein B [Xan... 82 2e-14
gi|26246610|ref|NP_752650.1| Lipoate-protein ligase B [Escherich... 82 2e-14
gi|33865202|ref|NP_896761.1| putative lipoate-protein ligase B [... 82 2e-14
gi|34498551|ref|NP_902766.1| lipoate-protein ligase B [Chromobac... 82 2e-14
gi|48850335|ref|ZP_00304577.1| COG0321: Lipoate-protein ligase B... 81 3e-14
gi|16759594|ref|NP_455211.1| lipoate-protein ligase B (lipoate b... 81 3e-14
gi|16419147|gb|AAL19586.1| putative ligase in lipoate biosynthes... 81 3e-14
gi|39546300|ref|NP_459627.2| putative ligase [Salmonella typhimu... 81 3e-14
gi|30173099|sp|Q8Z8I2|LIPB_SALTI Lipoyltransferase (Lipoyl-[acyl... 81 3e-14
gi|46443146|gb|EAL02430.1| hypothetical protein CaO19.10528 [Can... 81 4e-14
gi|21623162|gb|AAM67816.1| lipoate-protein ligase B [Buchnera ap... 80 6e-14
gi|30410818|ref|NP_660605.2| lipoate-protein ligase B [Buchnera ... 80 6e-14
gi|33860958|ref|NP_892519.1| putative lipoate-protein ligase B [... 80 8e-14
gi|23500333|ref|NP_699773.1| lipoate-protein ligase B [Brucella ... 80 8e-14
gi|13471382|ref|NP_102948.1| lipoate biosynthesis protein B [Mes... 80 8e-14
gi|15965149|ref|NP_385502.1| PROBABLE LIPOATE-PROTEIN LIGASE B [... 79 1e-13
gi|3122378|sp|Q00520|LIPB_PARVE Lipoyltransferase (Lipoyl-[acyl-... 79 1e-13
gi|46133661|ref|ZP_00157534.2| COG0321: Lipoate-protein ligase B... 79 1e-13
gi|33862487|ref|NP_894047.1| putative lipoate-protein ligase B [... 79 1e-13
gi|50427239|ref|XP_462232.1| unnamed protein product [Debaryomyc... 79 1e-13
gi|33239850|ref|NP_874792.1| Lipoate-protein ligase B [Prochloro... 79 1e-13
gi|33152980|ref|NP_874333.1| lipoate-protein ligase B; lipoate b... 79 1e-13
gi|24372745|ref|NP_716787.1| lipoate-protein ligase B [Shewanell... 79 1e-13
gi|48764417|ref|ZP_00268969.1| COG0321: Lipoate-protein ligase B... 79 2e-13
gi|16272002|ref|NP_438200.1| lipoate biosynthesis protein B [Hae... 79 2e-13
gi|48868744|ref|ZP_00322043.1| COG0321: Lipoate-protein ligase B... 78 2e-13
gi|46315355|ref|ZP_00215938.1| COG0321: Lipoate-protein ligase B... 78 2e-13
gi|49474259|ref|YP_032301.1| Lipoate biosynthesis protein B [Bar... 78 2e-13
gi|46320805|ref|ZP_00221189.1| COG0321: Lipoate-protein ligase B... 78 3e-13
gi|37679085|ref|NP_933694.1| lipoate-protein ligase B [Vibrio vu... 78 3e-13
gi|27363761|ref|NP_759289.1| Lipoate-protein ligase B [Vibrio vu... 78 3e-13
gi|49094914|ref|XP_408918.1| hypothetical protein AN4781.2 [Aspe... 78 3e-13
gi|15220259|ref|NP_175189.1| lipoyltransferase, putative [Arabid... 78 3e-13
gi|4887209|gb|AAD32236.1| lipoate biosynthesis protein B [Pseudo... 77 4e-13
gi|15599192|ref|NP_252686.1| lipoate-protein ligase B [Pseudomon... 77 4e-13
gi|46308766|ref|ZP_00210958.1| COG0321: Lipoate-protein ligase B... 77 5e-13
gi|32490924|ref|NP_871178.1| lipB [Wigglesworthia glossinidia en... 77 7e-13
gi|28897491|ref|NP_797096.1| lipoate-protein ligase B [Vibrio pa... 76 9e-13
gi|33860176|sp|Q9KTF8|LIPB_VIBCH Lipoyltransferase (Lipoyl-[acyl... 76 9e-13
gi|15640960|ref|NP_230591.1| lipoate-protein ligase B [Vibrio ch... 76 9e-13
gi|22996342|ref|ZP_00040602.1| COG0321: Lipoate-protein ligase B... 76 9e-13
gi|17545042|ref|NP_518444.1| PROBABLE LIPOATE-PROTEIN LIGASE B [... 76 9e-13
gi|26991481|ref|NP_746906.1| lipoate-protein ligase B [Pseudomon... 75 2e-12
gi|41149548|ref|XP_370636.1| similar to RIKEN cDNA 2610209A20 [H... 75 2e-12
gi|15805790|ref|NP_294488.1| lipoate-protein ligase B [Deinococc... 75 3e-12
gi|50085954|ref|YP_047464.1| lipoate-protein ligase B (Lipoate b... 74 4e-12
gi|15837871|ref|NP_298559.1| lipoate biosynthesis protein B [Xyl... 74 4e-12
gi|49475555|ref|YP_033596.1| Lipoate biosynthesis protein B [Bar... 74 4e-12
gi|32029461|ref|ZP_00132484.1| COG0321: Lipoate-protein ligase B... 74 5e-12
gi|48786413|ref|ZP_00282547.1| COG0321: Lipoate-protein ligase B... 74 5e-12
gi|23466581|ref|ZP_00122169.1| COG0321: Lipoate-protein ligase B... 74 5e-12
gi|47573862|ref|ZP_00243899.1| COG0321: Lipoate-protein ligase B... 74 5e-12
gi|49088878|gb|AAT51616.1| PA3997 [synthetic construct] 74 6e-12
gi|22994243|ref|ZP_00038754.1| COG0321: Lipoate-protein ligase B... 74 6e-12
gi|33599162|ref|NP_886722.1| lipoate-protein ligase B [Bordetell... 73 8e-12
gi|33594887|ref|NP_882530.1| lipoate-protein ligase B [Bordetell... 73 8e-12
gi|33591364|ref|NP_879008.1| lipoate-protein ligase B [Bordetell... 72 1e-11
gi|46128631|ref|XP_388869.1| hypothetical protein FG08693.1 [Gib... 72 1e-11
gi|15603794|ref|NP_246868.1| LipB [Pasteurella multocida Pm70] >... 71 3e-11
gi|48770544|ref|ZP_00274887.1| COG0321: Lipoate-protein ligase B... 71 3e-11
gi|50731411|ref|XP_425665.1| PREDICTED: similar to RIKEN cDNA 26... 71 4e-11
gi|27904745|ref|NP_777871.1| lipoate-protein ligase B [Buchnera ... 70 5e-11
gi|45515867|ref|ZP_00167421.1| COG0321: Lipoate-protein ligase B... 70 9e-11
gi|48851787|ref|ZP_00305984.1| COG0321: Lipoate-protein ligase B... 68 3e-10
gi|45657920|ref|YP_002006.1| lipoate protein ligase B [Leptospir... 68 3e-10
gi|24214431|ref|NP_711912.1| Lipoate-protein ligase B [Leptospir... 68 3e-10
gi|48852369|ref|ZP_00306556.1| COG0321: Lipoate-protein ligase B... 68 3e-10
gi|42522348|ref|NP_967728.1| lipB [Bdellovibrio bacteriovorus HD... 67 7e-10
gi|11465539|ref|NP_045070.1| lipoate biosynthesis protein B [Cya... 64 5e-09
gi|6685613|sp|O75627|LIPX_HUMAN Very potential lipoate-protein l... 59 1e-07
gi|25407705|pir||F85363 hypothetical protein AT4g31050 [imported... 56 1e-06
gi|3122366|sp|Q51854|LIPB_PROHO Lipoyltransferase (Lipoyl-[acyl-... 55 2e-06
gi|38103000|gb|EAA49765.1| hypothetical protein MG09756.4 [Magna... 54 5e-06
gi|46204230|ref|ZP_00050298.2| COG0321: Lipoate-protein ligase B... 51 4e-05
gi|27680577|ref|XP_213981.1| similar to mitochondrial ribosomal ... 49 2e-04
gi|25407707|pir||G85363 hypothetical protein AT4g31060 [imported... 48 3e-04
gi|31214682|ref|XP_315880.1| ENSANGP00000017500 [Anopheles gambi... 48 4e-04
gi|45478214|gb|AAS66278.1| LRRGT00187 [Rattus norvegicus] 48 4e-04
gi|26667174|ref|NP_751918.1| mitochondrial ribosomal protein L42... 47 5e-04
gi|7662637|ref|NP_054769.1| mitochondrial ribosomal protein L42 ... 47 5e-04
gi|7106798|gb|AAF36124.1| HSPC204 [Homo sapiens] 47 6e-04
gi|23115673|ref|ZP_00100624.1| COG0321: Lipoate-protein ligase B... 47 6e-04
gi|34865484|ref|XP_345957.1| similar to RIKEN cDNA 2900055D03 [R... 47 6e-04
gi|13385564|ref|NP_080341.1| RIKEN cDNA 2900055D03 [Mus musculus... 47 8e-04
gi|17647695|ref|NP_523673.1| CG12921-PA [Drosophila melanogaster... 45 0.002
gi|27718065|ref|XP_216882.1| similar to RIKEN cDNA 2900055D03 [R... 45 0.002
gi|50728484|ref|XP_416141.1| PREDICTED: similar to Mitochondrial... 44 0.004
gi|32408589|ref|XP_324776.1| hypothetical protein [Neurospora cr... 42 0.015
gi|20862296|ref|XP_122057.1| similar to RIKEN cDNA 2900055D03 [M... 42 0.015
gi|15811150|gb|AAL08828.1| hypothetical lipoate-protein ligase B... 42 0.025
gi|23612779|ref|NP_704318.1| lipoate-protein ligase, putative [P... 41 0.033
gi|23479584|gb|EAA16374.1| putative ligase in lipoate biosynthes... 40 0.074
gi|47222044|emb|CAG12070.1| unnamed protein product [Tetraodon n... 35 1.8
gi|30468086|ref|NP_848973.1| lipoate-protein ligase B [Cyanidios... 35 2.4
gi|28870896|ref|NP_793515.1| sigma-54 dependent transcriptional ... 35 3.1
gi|45508699|ref|ZP_00161036.1| COG0321: Lipoate-protein ligase B... 35 3.1
gi|38348256|ref|NP_940870.1| FLJ46180 protein [Homo sapiens] >gn... 34 5.3
gi|47572664|ref|ZP_00242706.1| COG5295: Autotransporter adhesin ... 34 5.3
gi|46318548|ref|ZP_00218993.1| COG2971: Predicted N-acetylglucos... 33 6.9
gi|38077408|ref|XP_357334.1| similar to Glycerol-3-phosphate acy... 33 6.9
gi|50760351|ref|XP_417983.1| PREDICTED: similar to complement C3... 33 6.9
gi|23508256|ref|NP_700925.1| hypothetical protein [Plasmodium fa... 33 6.9
gi|26788078|emb|CAD58751.1| SI:dZ172E19.1 (novel protein) [Danio... 33 9.1
>gi|13548492|emb|CAC35869.1| C. elegans LPL-1 protein (corresponding
sequence ZC410.7b) [Caenorhabditis elegans]
Length = 309
Score = 604 bits (1557), Expect = e-171
Identities = 298/309 (96%), Positives = 298/309 (96%)
Frame = -1
Query: 930 MLRNLFSITYRFASSDSPRKVVVCANGTIAAWHPPQHFPYEHTKPIDLGSLTKKDQXXXX 751
MLRNLFSITYRFASSDSPRKVVVCANGTIAAWHPPQHFPYEHTKPIDLGSLTKKDQ
Sbjct: 1 MLRNLFSITYRFASSDSPRKVVVCANGTIAAWHPPQHFPYEHTKPIDLGSLTKKDQSSRL 60
Query: 750 XXXXXXXSIPREPVNAELKDIFYTSKHEWYSRTREERLRNVAAPIPRHLVKANKSETHSL 571
SIPREPVNAELKDIFYTSKHEWYSRTREERLRNVAAPIPRHLVKANKSETHSL
Sbjct: 61 SAAAKASSIPREPVNAELKDIFYTSKHEWYSRTREERLRNVAAPIPRHLVKANKSETHSL 120
Query: 570 NFILALEHTPVYTVGIRSKGYTKEEETRLMRLGAEFHRTSRGGLITFHGPGQLVLYPICD 391
NFILALEHTPVYTVGIRSKGYTKEEETRLMRLGAEFHRTSRGGLITFHGPGQLVLYPICD
Sbjct: 121 NFILALEHTPVYTVGIRSKGYTKEEETRLMRLGAEFHRTSRGGLITFHGPGQLVLYPICD 180
Query: 390 VRRISIKQLDAATEGFGIKNVGRTANTGVWVSNERKLAAIGIAVSGGVSYHGIAINCNTD 211
VRRISIKQLDAATEGFGIKNVGRTANTGVWVSNERKLAAIGIAVSGGVSYHGIAINCNTD
Sbjct: 181 VRRISIKQLDAATEGFGIKNVGRTANTGVWVSNERKLAAIGIAVSGGVSYHGIAINCNTD 240
Query: 210 LRWFDNIVGCGIEGVSTTSLSQETSRNVTVSDARPILLNAFANNFECLLNEPNDYSTCSN 31
LRWFDNIVGCGIEGVSTTSLSQETSRNVTVSDARPILLNAFANNFECLLNEPNDYSTCSN
Sbjct: 241 LRWFDNIVGCGIEGVSTTSLSQETSRNVTVSDARPILLNAFANNFECLLNEPNDYSTCSN 300
Query: 30 LKITNVVSS 4
LKITNVVSS
Sbjct: 301 LKITNVVSS 309