Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZC434_2
(585 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508689|ref|NP_492708.1| ribosomal Protein, Small subunit (2... 383 e-105
gi|22758886|gb|AAN05602.1| ribosomal protein S7 [Argopecten irra... 234 9e-61
gi|20139944|sp|Q9NB21|RS7_CULQU 40S ribosomal protein S7 >gnl|BL... 233 3e-60
gi|50344464|emb|CAH04318.1| S7e ribosomal protein [Carabus granu... 231 6e-60
gi|31211175|ref|XP_314557.1| ENSANGP00000016949 [Anopheles gambi... 230 1e-59
gi|134026|sp|P02362|RS7_XENLA 40S RIBOSOMAL PROTEIN S7 (S8) >gnl... 230 2e-59
gi|49036473|sp|Q90YR7|RS7_ICTPU 40S ribosomal protein S7 >gnl|BL... 230 2e-59
gi|37181036|gb|AAQ88428.1| S7 ribosomal protein [Aedes aegypti] 229 2e-59
gi|1351005|sp|P48155|RS7_MANSE 40S RIBOSOMAL PROTEIN S7 >gnl|BL_... 229 3e-59
gi|35448695|gb|AAQ72566.2| ribosomal protein S7 [Anopheles dirus] 228 6e-59
gi|28630350|gb|AAN77896.1| ribosomal protein S7 [Petromyzon mari... 228 6e-59
gi|21358459|ref|NP_651782.1| CG1883-PA [Drosophila melanogaster]... 228 8e-59
gi|337518|gb|AAB00969.1| ribosomal protein 227 1e-58
gi|4506741|ref|NP_001002.1| ribosomal protein S7; 40S ribosomal ... 227 1e-58
gi|50744918|ref|XP_419936.1| PREDICTED: similar to ribosomal pro... 227 1e-58
gi|49036466|sp|P62085|RS7_DROYA 40S ribosomal protein S7 >gnl|BL... 226 2e-58
gi|50284384|emb|CAH04123.1| ribsomal protein S7e [Papilio dardanus] 225 4e-58
gi|50344466|emb|CAH04319.1| S7e ribosomal protein [Timarcha bale... 225 4e-58
gi|41152175|ref|NP_957046.1| hypothetical protein MGC73216 [Dani... 225 4e-58
gi|49532858|dbj|BAD26664.1| Ribosomal protein S7 [Plutella xylos... 225 5e-58
gi|49036475|sp|Q962S0|RS7_SPOFR 40S ribosomal protein S7 >gnl|BL... 224 7e-58
gi|464721|sp|P33514|RS7_ANOGA 40S RIBOSOMAL PROTEIN S7 >gnl|BL_O... 224 7e-58
gi|1710775|sp|P50894|RS7_FUGRU 40S RIBOSOMAL PROTEIN S7 >gnl|BL_... 224 1e-57
gi|38048347|gb|AAR10076.1| similar to Drosophila melanogaster CG... 224 1e-57
gi|41202587|ref|XP_370713.1| similar to bA271B5.1 (similar to ri... 222 4e-57
gi|41150725|ref|XP_371035.1| similar to 40S ribosomal protein S7... 222 4e-57
gi|929913|emb|CAA24703.1| ribosomal protein S8 [Xenopus laevis] 216 2e-55
gi|28630213|gb|AAN77893.1| ribosomal protein S7 [Scyliorhinus ca... 213 3e-54
gi|38081187|ref|XP_193332.2| similar to 40S ribosomal protein S7... 212 4e-54
gi|44967493|gb|AAS49572.1| ribosomal protein S7 [Protopterus dol... 211 8e-54
gi|44967447|gb|AAS49571.1| ribosomal protein S7 [Latimeria chalu... 211 1e-53
gi|38090306|ref|XP_193400.2| similar to 40S ribosomal protein S7... 208 5e-53
gi|37547120|ref|XP_015717.5| similar to 40S ribosomal protein S7... 206 2e-52
gi|28630209|gb|AAN77891.1| ribosomal protein S7 [Branchiostoma l... 202 3e-51
gi|28610081|gb|AAO48727.1| ribosomal protein S7 [Chelydra serpen... 202 4e-51
gi|38084287|ref|XP_144761.3| similar to 40S ribosomal protein S7... 196 2e-49
gi|14039950|gb|AAK53430.1| ribosomal protein S7 [Anopheles dirus] 195 6e-49
gi|24651339|ref|NP_733356.1| CG1883-PB [Drosophila melanogaster]... 194 8e-49
gi|49095184|ref|XP_409053.1| RS7_NEUCR 40S ribosomal protein S7 ... 193 2e-48
gi|34869384|ref|XP_223834.2| similar to 40S ribosomal protein S7... 193 2e-48
gi|50256692|gb|EAL19415.1| hypothetical protein CNBH1070 [Crypto... 192 4e-48
gi|29841135|gb|AAP06148.1| similar to GenBank Accession Number X... 192 4e-48
gi|38101630|gb|EAA48563.1| hypothetical protein MG00221.4 [Magna... 192 5e-48
gi|46124419|ref|XP_386763.1| RS7_NEUCR 40S ribosomal protein S7 ... 191 6e-48
gi|32403462|ref|XP_322344.1| 40S RIBOSOMAL PROTEIN S7 [Neurospor... 189 2e-47
gi|11276555|pir||T46586 ribosomal protein [imported] - Neurospor... 187 9e-47
gi|20139964|sp|Q9ZNS1|RS7_AVIMR 40S ribosomal protein S7 >gnl|BL... 187 2e-46
gi|15221972|ref|NP_175314.1| 40S ribosomal protein S7 (RPS7A) [A... 186 4e-46
gi|15232926|ref|NP_186905.1| 40S ribosomal protein S7 (RPS7B) [A... 182 5e-45
gi|13928774|ref|NP_113758.1| ribosomal protein S7 [Rattus norveg... 181 7e-45
gi|15237278|ref|NP_197117.1| 40S ribosomal protein S7 (RPS7C) [A... 181 9e-45
gi|21592413|gb|AAM64364.1| 40S ribosomal protein S7-like [Arabid... 181 1e-44
gi|49036471|sp|Q8LJU5|RS7_ORYSA 40S ribosomal protein S7 >gnl|BL... 180 2e-44
gi|19114589|ref|NP_593677.1| 40S ribosomal protein [Schizosaccha... 180 2e-44
gi|20139962|sp|Q9XH45|RS7_BRAOL 40S ribosomal protein S7 >gnl|BL... 178 6e-44
gi|50407763|ref|XP_456734.1| unnamed protein product [Debaryomyc... 176 3e-43
gi|49036478|sp|Q9XET4|RS7_SECCE 40S ribosomal protein S7 >gnl|BL... 174 8e-43
gi|49077636|ref|XP_402655.1| hypothetical protein UM05040.1 [Ust... 172 3e-42
gi|46443579|gb|EAL02860.1| hypothetical protein CaO19.9267 [Cand... 171 1e-41
gi|50305685|ref|XP_452803.1| unnamed protein product [Kluyveromy... 170 2e-41
gi|6324233|ref|NP_014303.1| Protein component of the small (40S)... 170 2e-41
gi|45185612|ref|NP_983328.1| ACL076Wp [Eremothecium gossypii] >g... 169 3e-41
gi|6324670|ref|NP_014739.1| Protein component of the small (40S)... 168 6e-41
gi|49036474|sp|Q949H0|RS7_HORVU 40S ribosomal protein S7 >gnl|BL... 167 2e-40
gi|38086137|ref|XP_290030.2| similar to 40S ribosomal protein S7... 166 2e-40
gi|1164943|emb|CAA64018.1| YOR3177w [Saccharomyces cerevisiae] 165 5e-40
gi|50288429|ref|XP_446644.1| unnamed protein product [Candida gl... 164 1e-39
gi|28630211|gb|AAN77892.1| ribosomal protein S7 [Myxine glutinosa] 162 5e-39
gi|50543580|ref|XP_499956.1| hypothetical protein [Yarrowia lipo... 161 9e-39
gi|23194422|gb|AAN15163.1| ribosomal protein S7 [Anopheles steph... 154 1e-36
gi|47214631|emb|CAG01472.1| unnamed protein product [Tetraodon n... 150 1e-35
gi|34880264|ref|XP_222652.2| similar to 40S ribosomal protein S7... 147 2e-34
gi|38086774|ref|XP_142193.4| similar to 40S ribosomal protein S7... 145 7e-34
gi|34881255|ref|XP_346328.1| similar to 40S ribosomal protein S7... 132 6e-30
gi|46227275|gb|EAK88225.1| 40S ribosomal protein S7 [Cryptospori... 118 9e-26
gi|23618965|ref|NP_704927.1| 40S ribosomal protein S7 homologue,... 117 2e-25
gi|23478661|gb|EAA15687.1| Ribosomal protein S7e [Plasmodium yoe... 116 3e-25
gi|34864727|ref|XP_345951.1| similar to 40S ribosomal protein S7... 114 1e-24
gi|29246805|gb|EAA38388.1| GLP_0_7665_7093 [Giardia lamblia ATCC... 108 9e-23
gi|11466131|ref|NP_047064.1| RPS7; L1231.4 [Leishmania major] >g... 102 4e-21
gi|34855946|ref|XP_342701.1| similar to hypothetical protein FLJ... 93 3e-18
gi|34877122|ref|XP_344482.1| similar to 60S ribosomal protein L2... 86 5e-16
gi|34876509|ref|XP_225493.2| similar to 40S ribosomal protein S7... 80 2e-14
gi|46390251|dbj|BAD15680.1| putative ribosomal protein S7 [Oryza... 78 1e-13
gi|34866231|ref|XP_345691.1| similar to 40S ribosomal protein S7... 70 4e-11
gi|38096180|ref|XP_142333.2| similar to 40S ribosomal protein S7... 67 2e-10
gi|32401381|gb|AAP80860.1| ribosomal protein S7 [Triticum aestivum] 61 1e-08
gi|24421249|gb|AAN60803.1| 40S ribosomal protein S7 [Oncorhynchu... 57 3e-07
gi|1351007|sp|P47839|RS7_SALSA 40S RIBOSOMAL PROTEIN S7 >gnl|BL_... 49 5e-05
gi|42780061|ref|NP_977308.1| conserved domain protein [Bacillus ... 37 0.20
gi|16264590|ref|NP_437382.1| phosphate uptake ABC transporter pe... 36 0.59
gi|14590584|ref|NP_142652.1| hypothetical protein PH0706 [Pyroco... 35 0.77
gi|14521538|ref|NP_127014.1| hypothetical protein PAB1492 [Pyroc... 35 0.77
gi|50417662|gb|AAH77777.1| Unknown (protein for MGC:80102) [Xeno... 35 0.77
gi|50770131|ref|XP_427061.1| PREDICTED: similar to CABP1 protein... 35 1.3
gi|18977586|ref|NP_578943.1| hypothetical protein PF1214 [Pyroco... 35 1.3
gi|50425181|ref|XP_461182.1| unnamed protein product [Debaryomyc... 35 1.3
gi|32412378|ref|XP_326669.1| predicted protein [Neurospora crass... 35 1.3
gi|30017511|gb|AAP12933.1| putative cell division control protei... 34 1.7
gi|50745471|ref|XP_420128.1| PREDICTED: similar to cask-interact... 34 2.2
gi|13542312|ref|NP_112000.1| Predicted ATPase (AAA+ superfamily)... 33 3.8
gi|159619|gb|AAA29366.1| ORF1; has homology with nucleic acid bi... 33 3.8
gi|48846156|ref|ZP_00300422.1| COG0481: Membrane GTPase LepA [Ge... 33 5.0
gi|20808321|ref|NP_623492.1| Cell division protein FtsI/penicill... 33 5.0
gi|39753477|gb|AAR30323.1| ornithine carbamyltransferase [Strept... 33 5.0
gi|47227710|emb|CAG09707.1| unnamed protein product [Tetraodon n... 33 5.0
gi|17534309|ref|NP_494220.1| microtubule Associated Protein (2C5... 32 6.5
gi|16122514|ref|NP_405827.1| putative virulence factor [Yersinia... 32 6.5
gi|22126010|ref|NP_669433.1| putative virulence factor [Yersinia... 32 6.5
gi|17540794|ref|NP_502196.1| methionyl tRNA Synthetase (101.7 kD... 32 6.5
gi|49035117|gb|AAF35965.3| Hypothetical protein F54A3.1 [Caenorh... 32 6.5
gi|39580309|emb|CAE56044.1| Hypothetical protein CBG23610 [Caeno... 32 6.5
gi|20090414|ref|NP_616489.1| hypothetical protein (multi-domain)... 32 6.5
gi|39996368|ref|NP_952319.1| GTP-binding protein LepA [Geobacter... 32 6.5
gi|48770441|ref|ZP_00274784.1| COG0665: Glycine/D-amino acid oxi... 32 6.5
gi|49083800|ref|XP_404153.1| hypothetical protein AN0016.2 [Aspe... 32 8.5
gi|49067436|ref|XP_398008.1| hypothetical protein UM00393.1 [Ust... 32 8.5
gi|15601281|ref|NP_232912.1| exonuclease SbcC, putative [Vibrio ... 32 8.5
gi|50417426|gb|AAH77232.1| Unknown (protein for MGC:79076) [Xeno... 32 8.5
gi|32492226|emb|CAE03677.1| OSJNBa0042N22.21 [Oryza sativa (japo... 32 8.5
gi|24649535|ref|NP_651211.2| CG6057-PA [Drosophila melanogaster]... 32 8.5
gi|7159657|emb|CAB76376.1| SMC1 protein [Drosophila melanogaster... 32 8.5
gi|32410991|ref|XP_325976.1| predicted protein [Neurospora crass... 32 8.5
>gi|17508689|ref|NP_492708.1| ribosomal Protein, Small subunit (22.1
kD) (rps-7) [Caenorhabditis elegans]
gi|49036468|sp|Q23312|RS7_CAEEL 40S ribosomal protein S7
gi|7510753|pir||T27565 hypothetical protein ZC434.2 -
Caenorhabditis elegans
gi|3925370|emb|CAB00058.1| Hypothetical protein ZC434.2
[Caenorhabditis elegans]
gi|39580089|emb|CAE73793.1| Hypothetical protein CBG21343
[Caenorhabditis briggsae]
Length = 194
Score = 383 bits (984), Expect = e-105
Identities = 194/194 (100%), Positives = 194/194 (100%)
Frame = +1
Query: 1 MPEIIGKLLKSDGKVVSEIEKQVSQALIDLETNDDVQSQLKELYIVGVKEVELGNKSAII 180
MPEIIGKLLKSDGKVVSEIEKQVSQALIDLETNDDVQSQLKELYIVGVKEVELGNKSAII
Sbjct: 1 MPEIIGKLLKSDGKVVSEIEKQVSQALIDLETNDDVQSQLKELYIVGVKEVELGNKSAII 60
Query: 181 IYVPVPQLKAFHKIHPALVRELEKKFGGRDILILAKRRILPKPQRGSKARPQKQKRPRSR 360
IYVPVPQLKAFHKIHPALVRELEKKFGGRDILILAKRRILPKPQRGSKARPQKQKRPRSR
Sbjct: 61 IYVPVPQLKAFHKIHPALVRELEKKFGGRDILILAKRRILPKPQRGSKARPQKQKRPRSR 120
Query: 361 TLTAVHDAWLDELVYPAEVVGRRIRVKLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKL 540
TLTAVHDAWLDELVYPAEVVGRRIRVKLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKL
Sbjct: 121 TLTAVHDAWLDELVYPAEVVGRRIRVKLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKL 180
Query: 541 TGKDVTFEFPDPIF 582
TGKDVTFEFPDPIF
Sbjct: 181 TGKDVTFEFPDPIF 194