Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= ZC434_2
         (585 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17508689|ref|NP_492708.1| ribosomal Protein, Small subunit (2...   383   e-105
gi|22758886|gb|AAN05602.1| ribosomal protein S7 [Argopecten irra...   234   9e-61
gi|20139944|sp|Q9NB21|RS7_CULQU 40S ribosomal protein S7 >gnl|BL...   233   3e-60
gi|50344464|emb|CAH04318.1| S7e ribosomal protein [Carabus granu...   231   6e-60
gi|31211175|ref|XP_314557.1| ENSANGP00000016949 [Anopheles gambi...   230   1e-59
gi|134026|sp|P02362|RS7_XENLA 40S RIBOSOMAL PROTEIN S7 (S8) >gnl...   230   2e-59
gi|49036473|sp|Q90YR7|RS7_ICTPU 40S ribosomal protein S7 >gnl|BL...   230   2e-59
gi|37181036|gb|AAQ88428.1| S7 ribosomal protein [Aedes aegypti]       229   2e-59
gi|1351005|sp|P48155|RS7_MANSE 40S RIBOSOMAL PROTEIN S7 >gnl|BL_...   229   3e-59
gi|35448695|gb|AAQ72566.2| ribosomal protein S7 [Anopheles dirus]     228   6e-59
gi|28630350|gb|AAN77896.1| ribosomal protein S7 [Petromyzon mari...   228   6e-59
gi|21358459|ref|NP_651782.1| CG1883-PA [Drosophila melanogaster]...   228   8e-59
gi|337518|gb|AAB00969.1| ribosomal protein                            227   1e-58
gi|4506741|ref|NP_001002.1| ribosomal protein S7; 40S ribosomal ...   227   1e-58
gi|50744918|ref|XP_419936.1| PREDICTED: similar to ribosomal pro...   227   1e-58
gi|49036466|sp|P62085|RS7_DROYA 40S ribosomal protein S7 >gnl|BL...   226   2e-58
gi|50284384|emb|CAH04123.1| ribsomal protein S7e [Papilio dardanus]   225   4e-58
gi|50344466|emb|CAH04319.1| S7e ribosomal protein [Timarcha bale...   225   4e-58
gi|41152175|ref|NP_957046.1| hypothetical protein MGC73216 [Dani...   225   4e-58
gi|49532858|dbj|BAD26664.1| Ribosomal protein S7 [Plutella xylos...   225   5e-58
gi|49036475|sp|Q962S0|RS7_SPOFR 40S ribosomal protein S7 >gnl|BL...   224   7e-58
gi|464721|sp|P33514|RS7_ANOGA 40S RIBOSOMAL PROTEIN S7 >gnl|BL_O...   224   7e-58
gi|1710775|sp|P50894|RS7_FUGRU 40S RIBOSOMAL PROTEIN S7 >gnl|BL_...   224   1e-57
gi|38048347|gb|AAR10076.1| similar to Drosophila melanogaster CG...   224   1e-57
gi|41202587|ref|XP_370713.1| similar to bA271B5.1 (similar to ri...   222   4e-57
gi|41150725|ref|XP_371035.1| similar to 40S ribosomal protein S7...   222   4e-57
gi|929913|emb|CAA24703.1| ribosomal protein S8 [Xenopus laevis]       216   2e-55
gi|28630213|gb|AAN77893.1| ribosomal protein S7 [Scyliorhinus ca...   213   3e-54
gi|38081187|ref|XP_193332.2| similar to 40S ribosomal protein S7...   212   4e-54
gi|44967493|gb|AAS49572.1| ribosomal protein S7 [Protopterus dol...   211   8e-54
gi|44967447|gb|AAS49571.1| ribosomal protein S7 [Latimeria chalu...   211   1e-53
gi|38090306|ref|XP_193400.2| similar to 40S ribosomal protein S7...   208   5e-53
gi|37547120|ref|XP_015717.5| similar to 40S ribosomal protein S7...   206   2e-52
gi|28630209|gb|AAN77891.1| ribosomal protein S7 [Branchiostoma l...   202   3e-51
gi|28610081|gb|AAO48727.1| ribosomal protein S7 [Chelydra serpen...   202   4e-51
gi|38084287|ref|XP_144761.3| similar to 40S ribosomal protein S7...   196   2e-49
gi|14039950|gb|AAK53430.1| ribosomal protein S7 [Anopheles dirus]     195   6e-49
gi|24651339|ref|NP_733356.1| CG1883-PB [Drosophila melanogaster]...   194   8e-49
gi|49095184|ref|XP_409053.1| RS7_NEUCR 40S ribosomal protein S7 ...   193   2e-48
gi|34869384|ref|XP_223834.2| similar to 40S ribosomal protein S7...   193   2e-48
gi|50256692|gb|EAL19415.1| hypothetical protein CNBH1070 [Crypto...   192   4e-48
gi|29841135|gb|AAP06148.1| similar to GenBank Accession Number X...   192   4e-48
gi|38101630|gb|EAA48563.1| hypothetical protein MG00221.4 [Magna...   192   5e-48
gi|46124419|ref|XP_386763.1| RS7_NEUCR 40S ribosomal protein S7 ...   191   6e-48
gi|32403462|ref|XP_322344.1| 40S RIBOSOMAL PROTEIN S7 [Neurospor...   189   2e-47
gi|11276555|pir||T46586 ribosomal protein [imported] - Neurospor...   187   9e-47
gi|20139964|sp|Q9ZNS1|RS7_AVIMR 40S ribosomal protein S7 >gnl|BL...   187   2e-46
gi|15221972|ref|NP_175314.1| 40S ribosomal protein S7 (RPS7A) [A...   186   4e-46
gi|15232926|ref|NP_186905.1| 40S ribosomal protein S7 (RPS7B) [A...   182   5e-45
gi|13928774|ref|NP_113758.1| ribosomal protein S7 [Rattus norveg...   181   7e-45
gi|15237278|ref|NP_197117.1| 40S ribosomal protein S7 (RPS7C) [A...   181   9e-45
gi|21592413|gb|AAM64364.1| 40S ribosomal protein S7-like [Arabid...   181   1e-44
gi|49036471|sp|Q8LJU5|RS7_ORYSA 40S ribosomal protein S7 >gnl|BL...   180   2e-44
gi|19114589|ref|NP_593677.1| 40S ribosomal protein [Schizosaccha...   180   2e-44
gi|20139962|sp|Q9XH45|RS7_BRAOL 40S ribosomal protein S7 >gnl|BL...   178   6e-44
gi|50407763|ref|XP_456734.1| unnamed protein product [Debaryomyc...   176   3e-43
gi|49036478|sp|Q9XET4|RS7_SECCE 40S ribosomal protein S7 >gnl|BL...   174   8e-43
gi|49077636|ref|XP_402655.1| hypothetical protein UM05040.1 [Ust...   172   3e-42
gi|46443579|gb|EAL02860.1| hypothetical protein CaO19.9267 [Cand...   171   1e-41
gi|50305685|ref|XP_452803.1| unnamed protein product [Kluyveromy...   170   2e-41
gi|6324233|ref|NP_014303.1| Protein component of the small (40S)...   170   2e-41
gi|45185612|ref|NP_983328.1| ACL076Wp [Eremothecium gossypii] >g...   169   3e-41
gi|6324670|ref|NP_014739.1| Protein component of the small (40S)...   168   6e-41
gi|49036474|sp|Q949H0|RS7_HORVU 40S ribosomal protein S7 >gnl|BL...   167   2e-40
gi|38086137|ref|XP_290030.2| similar to 40S ribosomal protein S7...   166   2e-40
gi|1164943|emb|CAA64018.1| YOR3177w [Saccharomyces cerevisiae]        165   5e-40
gi|50288429|ref|XP_446644.1| unnamed protein product [Candida gl...   164   1e-39
gi|28630211|gb|AAN77892.1| ribosomal protein S7 [Myxine glutinosa]    162   5e-39
gi|50543580|ref|XP_499956.1| hypothetical protein [Yarrowia lipo...   161   9e-39
gi|23194422|gb|AAN15163.1| ribosomal protein S7 [Anopheles steph...   154   1e-36
gi|47214631|emb|CAG01472.1| unnamed protein product [Tetraodon n...   150   1e-35
gi|34880264|ref|XP_222652.2| similar to 40S ribosomal protein S7...   147   2e-34
gi|38086774|ref|XP_142193.4| similar to 40S ribosomal protein S7...   145   7e-34
gi|34881255|ref|XP_346328.1| similar to 40S ribosomal protein S7...   132   6e-30
gi|46227275|gb|EAK88225.1| 40S ribosomal protein S7 [Cryptospori...   118   9e-26
gi|23618965|ref|NP_704927.1| 40S ribosomal protein S7 homologue,...   117   2e-25
gi|23478661|gb|EAA15687.1| Ribosomal protein S7e [Plasmodium yoe...   116   3e-25
gi|34864727|ref|XP_345951.1| similar to 40S ribosomal protein S7...   114   1e-24
gi|29246805|gb|EAA38388.1| GLP_0_7665_7093 [Giardia lamblia ATCC...   108   9e-23
gi|11466131|ref|NP_047064.1| RPS7; L1231.4 [Leishmania major] >g...   102   4e-21
gi|34855946|ref|XP_342701.1| similar to hypothetical protein FLJ...    93   3e-18
gi|34877122|ref|XP_344482.1| similar to 60S ribosomal protein L2...    86   5e-16
gi|34876509|ref|XP_225493.2| similar to 40S ribosomal protein S7...    80   2e-14
gi|46390251|dbj|BAD15680.1| putative ribosomal protein S7 [Oryza...    78   1e-13
gi|34866231|ref|XP_345691.1| similar to 40S ribosomal protein S7...    70   4e-11
gi|38096180|ref|XP_142333.2| similar to 40S ribosomal protein S7...    67   2e-10
gi|32401381|gb|AAP80860.1| ribosomal protein S7 [Triticum aestivum]    61   1e-08
gi|24421249|gb|AAN60803.1| 40S ribosomal protein S7 [Oncorhynchu...    57   3e-07
gi|1351007|sp|P47839|RS7_SALSA 40S RIBOSOMAL PROTEIN S7 >gnl|BL_...    49   5e-05
gi|42780061|ref|NP_977308.1| conserved domain protein [Bacillus ...    37   0.20
gi|16264590|ref|NP_437382.1| phosphate uptake ABC transporter pe...    36   0.59
gi|14590584|ref|NP_142652.1| hypothetical protein PH0706 [Pyroco...    35   0.77
gi|14521538|ref|NP_127014.1| hypothetical protein PAB1492 [Pyroc...    35   0.77
gi|50417662|gb|AAH77777.1| Unknown (protein for MGC:80102) [Xeno...    35   0.77
gi|50770131|ref|XP_427061.1| PREDICTED: similar to CABP1 protein...    35   1.3
gi|18977586|ref|NP_578943.1| hypothetical protein PF1214 [Pyroco...    35   1.3
gi|50425181|ref|XP_461182.1| unnamed protein product [Debaryomyc...    35   1.3
gi|32412378|ref|XP_326669.1| predicted protein [Neurospora crass...    35   1.3
gi|30017511|gb|AAP12933.1| putative cell division control protei...    34   1.7
gi|50745471|ref|XP_420128.1| PREDICTED: similar to cask-interact...    34   2.2
gi|13542312|ref|NP_112000.1| Predicted ATPase (AAA+ superfamily)...    33   3.8
gi|159619|gb|AAA29366.1| ORF1; has homology with nucleic acid bi...    33   3.8
gi|48846156|ref|ZP_00300422.1| COG0481: Membrane GTPase LepA [Ge...    33   5.0
gi|20808321|ref|NP_623492.1| Cell division protein FtsI/penicill...    33   5.0
gi|39753477|gb|AAR30323.1| ornithine carbamyltransferase [Strept...    33   5.0
gi|47227710|emb|CAG09707.1| unnamed protein product [Tetraodon n...    33   5.0
gi|17534309|ref|NP_494220.1| microtubule Associated Protein (2C5...    32   6.5
gi|16122514|ref|NP_405827.1| putative virulence factor [Yersinia...    32   6.5
gi|22126010|ref|NP_669433.1| putative virulence factor [Yersinia...    32   6.5
gi|17540794|ref|NP_502196.1| methionyl tRNA Synthetase (101.7 kD...    32   6.5
gi|49035117|gb|AAF35965.3| Hypothetical protein F54A3.1 [Caenorh...    32   6.5
gi|39580309|emb|CAE56044.1| Hypothetical protein CBG23610 [Caeno...    32   6.5
gi|20090414|ref|NP_616489.1| hypothetical protein (multi-domain)...    32   6.5
gi|39996368|ref|NP_952319.1| GTP-binding protein LepA [Geobacter...    32   6.5
gi|48770441|ref|ZP_00274784.1| COG0665: Glycine/D-amino acid oxi...    32   6.5
gi|49083800|ref|XP_404153.1| hypothetical protein AN0016.2 [Aspe...    32   8.5
gi|49067436|ref|XP_398008.1| hypothetical protein UM00393.1 [Ust...    32   8.5
gi|15601281|ref|NP_232912.1| exonuclease SbcC, putative [Vibrio ...    32   8.5
gi|50417426|gb|AAH77232.1| Unknown (protein for MGC:79076) [Xeno...    32   8.5
gi|32492226|emb|CAE03677.1| OSJNBa0042N22.21 [Oryza sativa (japo...    32   8.5
gi|24649535|ref|NP_651211.2| CG6057-PA [Drosophila melanogaster]...    32   8.5
gi|7159657|emb|CAB76376.1| SMC1 protein [Drosophila melanogaster...    32   8.5
gi|32410991|ref|XP_325976.1| predicted protein [Neurospora crass...    32   8.5


>gi|17508689|ref|NP_492708.1| ribosomal Protein, Small subunit (22.1
           kD) (rps-7) [Caenorhabditis elegans]
 gi|49036468|sp|Q23312|RS7_CAEEL 40S ribosomal protein S7
 gi|7510753|pir||T27565 hypothetical protein ZC434.2 -
           Caenorhabditis elegans
 gi|3925370|emb|CAB00058.1| Hypothetical protein ZC434.2
           [Caenorhabditis elegans]
 gi|39580089|emb|CAE73793.1| Hypothetical protein CBG21343
           [Caenorhabditis briggsae]
          Length = 194

 Score =  383 bits (984), Expect = e-105
 Identities = 194/194 (100%), Positives = 194/194 (100%)
 Frame = +1

Query: 1   MPEIIGKLLKSDGKVVSEIEKQVSQALIDLETNDDVQSQLKELYIVGVKEVELGNKSAII 180
           MPEIIGKLLKSDGKVVSEIEKQVSQALIDLETNDDVQSQLKELYIVGVKEVELGNKSAII
Sbjct: 1   MPEIIGKLLKSDGKVVSEIEKQVSQALIDLETNDDVQSQLKELYIVGVKEVELGNKSAII 60

Query: 181 IYVPVPQLKAFHKIHPALVRELEKKFGGRDILILAKRRILPKPQRGSKARPQKQKRPRSR 360
           IYVPVPQLKAFHKIHPALVRELEKKFGGRDILILAKRRILPKPQRGSKARPQKQKRPRSR
Sbjct: 61  IYVPVPQLKAFHKIHPALVRELEKKFGGRDILILAKRRILPKPQRGSKARPQKQKRPRSR 120

Query: 361 TLTAVHDAWLDELVYPAEVVGRRIRVKLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKL 540
           TLTAVHDAWLDELVYPAEVVGRRIRVKLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKL
Sbjct: 121 TLTAVHDAWLDELVYPAEVVGRRIRVKLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKL 180

Query: 541 TGKDVTFEFPDPIF 582
           TGKDVTFEFPDPIF
Sbjct: 181 TGKDVTFEFPDPIF 194




[DB home][top]