Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK1010_5
(2271 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17557095|ref|NP_499698.1| polycystic kidney disease 1-like 3 ... 967 0.0
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 99 4e-19
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma... 99 6e-19
gi|477072|pir||A48018 mucin 7 precursor, salivary - human 99 6e-19
gi|22748665|ref|NP_689504.1| mucin 7, salivary [Homo sapiens] >g... 97 1e-18
gi|45552373|ref|NP_995709.1| CG32972-PA [Drosophila melanogaster... 85 9e-15
gi|7287821|gb|AAF44859.1| hypothetical protein [Drosophila melan... 85 9e-15
gi|31559809|ref|NP_853522.1| polycystic kidney disease 1 like 3;... 83 2e-14
gi|5031925|ref|NP_005798.1| proteoglycan 4; megakaryocyte stimul... 83 3e-14
gi|42659989|ref|XP_377262.1| similar to Hypothetical protein CBG... 82 4e-14
gi|13559026|emb|CAC36090.1| bG174L6.2 (MSF: megakaryocyte stimul... 81 1e-13
gi|39592304|emb|CAE75525.1| Hypothetical protein CBG23547 [Caeno... 79 5e-13
gi|22970264|ref|ZP_00017376.1| hypothetical protein [Chloroflexu... 79 6e-13
gi|50548313|ref|XP_501626.1| hypothetical protein [Yarrowia lipo... 78 8e-13
gi|7209719|dbj|BAA92310.1| This gene is isolated by means of dif... 77 1e-12
gi|46444373|gb|EAL03648.1| hypothetical protein CaO19.9067 [Cand... 77 1e-12
gi|38073487|ref|XP_355243.1| similar to This gene is isolated by... 77 2e-12
gi|188864|gb|AAA59875.1| mucin 73 3e-11
gi|186396|gb|AAA59163.1| mucin 72 6e-11
gi|2135765|pir||A43932 mucin 2 precursor, intestinal - human (fr... 72 6e-11
gi|4505285|ref|NP_002448.1| mucin 2 [Homo sapiens] >gnl|BL_ORD_I... 72 6e-11
gi|15219387|ref|NP_178066.1| hypothetical protein [Arabidopsis t... 72 8e-11
gi|31206185|ref|XP_312044.1| ENSANGP00000016899 [Anopheles gambi... 72 8e-11
gi|15233976|ref|NP_193602.1| leucine-rich repeat family protein ... 71 1e-10
gi|50545139|ref|XP_500107.1| hypothetical protein [Yarrowia lipo... 70 2e-10
gi|39584067|emb|CAE66473.1| Hypothetical protein CBG11752 [Caeno... 70 2e-10
gi|39581385|emb|CAE69282.1| Hypothetical protein CBG15336 [Caeno... 69 5e-10
gi|22026893|ref|NP_611285.2| CG5765-PA [Drosophila melanogaster]... 69 6e-10
gi|32565289|ref|NP_499617.2| putative membrane protein (3N487) [... 68 1e-09
gi|7510032|pir||T27051 hypothetical protein Y49E10.10 - Caenorha... 68 1e-09
gi|17534551|ref|NP_494923.1| putative protein (2F299) [Caenorhab... 67 1e-09
gi|24641644|ref|NP_727652.1| CG32644-PB [Drosophila melanogaster... 67 2e-09
gi|17568719|ref|NP_508292.1| putative protein family member (XC1... 66 4e-09
gi|45185256|ref|NP_982973.1| ABR027Cp [Eremothecium gossypii] >g... 66 4e-09
gi|39590335|emb|CAE66074.1| Hypothetical protein CBG11288 [Caeno... 65 5e-09
gi|17561512|ref|NP_506158.1| predicted CDS, putative protein fam... 65 7e-09
gi|31232507|ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambi... 65 7e-09
gi|45553053|ref|NP_996054.1| CG18331-PA [Drosophila melanogaster... 64 1e-08
gi|39597748|emb|CAE68440.1| Hypothetical protein CBG14225 [Caeno... 64 2e-08
gi|39581822|emb|CAE60715.1| Hypothetical protein CBG04386 [Caeno... 63 3e-08
gi|45383540|ref|NP_989631.1| enabled homolog [Gallus gallus] >gn... 63 3e-08
gi|9629583|ref|NP_044888.1| glycoprotein 150 [murid herpesvirus ... 63 3e-08
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib... 62 5e-08
gi|27801767|emb|CAB46564.2| hypothetical protein [Streptococcus ... 62 6e-08
gi|46226738|gb|EAK87717.1| uncharacterized secreted protein with... 62 8e-08
gi|15828996|ref|NP_326356.1| LIPOPROTEIN VSAC (FRAGMENT) [Mycopl... 62 8e-08
gi|42779687|ref|NP_976934.1| internalin, putative [Bacillus cere... 62 8e-08
gi|2136504|pir||I47141 gastric mucin (clone PGM-2A) - pig (fragm... 61 1e-07
gi|7446482|pir||S71558 probable cell wall-plasma membrane linker... 61 1e-07
gi|111978|pir||S24169 mucin - rat 61 1e-07
gi|29377906|ref|NP_817032.1| surface protein PrgC [Enterococcus ... 61 1e-07
gi|45201234|ref|NP_986804.1| AGR138Wp [Eremothecium gossypii] >g... 61 1e-07
gi|50547897|ref|XP_501418.1| hypothetical protein [Yarrowia lipo... 60 2e-07
gi|50804055|ref|XP_424297.1| PREDICTED: similar to Hypothetical ... 60 2e-07
gi|9759597|dbj|BAB11454.1| unnamed protein product [Arabidopsis ... 60 2e-07
gi|9965400|gb|AAG10075.1| membrane virion glycoprotein 150 [muri... 60 2e-07
gi|5305335|gb|AAD41594.1| proline-rich mucin homolog [Mycobacter... 60 2e-07
gi|31231947|ref|XP_318620.1| ENSANGP00000020885 [Anopheles gambi... 60 2e-07
gi|1076802|pir||S49915 extensin-like protein - maize >gnl|BL_ORD... 60 3e-07
gi|1085433|pir||S55316 mucin (clone PGM-2B) - pig >gnl|BL_ORD_ID... 60 3e-07
gi|15839664|ref|NP_334701.1| hypothetical protein [Mycobacterium... 60 3e-07
gi|97901|pir||A41826 probable pheromone-responsive protein C pre... 60 3e-07
gi|6322209|ref|NP_012284.1| GPI-anchored cell surface glycoprote... 60 3e-07
gi|24646199|ref|NP_731674.1| CG4795-PB [Drosophila melanogaster]... 60 3e-07
gi|16182657|gb|AAL13544.1| GH08002p [Drosophila melanogaster] 60 3e-07
gi|50556110|ref|XP_505463.1| hypothetical protein [Yarrowia lipo... 60 3e-07
gi|17566006|ref|NP_505150.1| putative protein (5I806) [Caenorhab... 59 4e-07
gi|20521149|dbj|BAA34474.2| KIAA0754 protein [Homo sapiens] 59 4e-07
gi|16122929|ref|NP_406242.1| conserved hypothetical protein [Yer... 59 4e-07
gi|416833|sp|Q02910|CPN_DROME Calphotin >gnl|BL_ORD_ID|454593 gi... 59 5e-07
gi|46201942|ref|ZP_00054046.2| COG3210: Large exoproteins involv... 59 5e-07
gi|38492189|gb|AAR22399.1| antigenic cell wall protein MP2 [Aspe... 59 5e-07
gi|19527573|gb|AAL89901.1| RE37683p [Drosophila melanogaster] 59 5e-07
gi|15240947|ref|NP_198672.1| protein kinase family protein [Arab... 59 7e-07
gi|423789|pir||A47283 calphotin - fruit fly (Drosophila melanoga... 58 9e-07
gi|50290767|ref|XP_447816.1| unnamed protein product [Candida gl... 58 9e-07
gi|34880471|ref|XP_213903.2| similar to This gene is isolated by... 58 9e-07
gi|34894174|ref|NP_908412.1| putative protein kinase [Oryza sati... 58 9e-07
gi|3617766|emb|CAA09389.1| ICHIT protein [Anopheles gambiae] 58 9e-07
gi|27469167|ref|NP_765804.1| streptococcal hemagglutinin protein... 58 1e-06
gi|548937|sp|Q06852|SLP1_CLOTM CELL SURFACE GLYCOPROTEIN 1 PRECU... 58 1e-06
gi|37962902|gb|AAR05805.1| ICHIT [Anopheles gambiae] 57 1e-06
gi|33310026|gb|AAQ03243.1| putative cell wall protein FLO11p [Ca... 57 2e-06
gi|24646197|ref|NP_731673.1| CG4795-PA [Drosophila melanogaster]... 57 2e-06
gi|32419975|ref|XP_330431.1| hypothetical protein [Neurospora cr... 57 2e-06
gi|48858286|ref|ZP_00312245.1| hypothetical protein Chte02002468... 57 3e-06
gi|38109209|gb|EAA55116.1| predicted protein [Magnaporthe grisea... 57 3e-06
gi|11994733|dbj|BAB03062.1| unnamed protein product [Arabidopsis... 57 3e-06
gi|13492037|gb|AAK28052.1| Zonadhesin >gnl|BL_ORD_ID|1548452 gi|... 57 3e-06
gi|11602812|dbj|BAB18910.1| avenaIII [Gallus gallus] 57 3e-06
gi|7446488|pir||T10064 cytokinin-induced proline rich protein - ... 57 3e-06
gi|45553073|ref|NP_996064.1| CG33265-PA [Drosophila melanogaster... 56 3e-06
gi|17550358|ref|NP_508603.1| putative protein, with at least 2 t... 56 4e-06
gi|25404764|pir||D96711 hypothetical protein F24J5.8 [imported] ... 55 6e-06
gi|24641972|ref|NP_727775.1| CG32602-PB [Drosophila melanogaster... 55 6e-06
gi|24641970|ref|NP_727774.1| CG32602-PA [Drosophila melanogaster... 55 6e-06
gi|38083062|ref|XP_289814.2| similar to Zonadhesin [Mus musculus] 55 6e-06
gi|47077384|dbj|BAD18580.1| unnamed protein product [Homo sapiens] 55 6e-06
gi|39584066|emb|CAE66472.1| Hypothetical protein CBG11751 [Caeno... 55 7e-06
gi|7657285|ref|NP_056624.1| keratin associated protein 5-4; kera... 55 1e-05
gi|48696793|ref|YP_024617.1| ORF78 [Ostreid herpesvirus 1] >gnl|... 55 1e-05
gi|24639647|ref|NP_726915.1| CG32774-PA [Drosophila melanogaster... 55 1e-05
gi|22972947|ref|ZP_00019797.1| hypothetical protein [Chloroflexu... 54 1e-05
gi|37962904|gb|AAR05806.1| ICHIT [Anopheles gambiae] 54 1e-05
gi|38091566|ref|XP_137519.4| similar to KIAA0754 protein [Mus mu... 54 1e-05
gi|7495878|pir||T29634 hypothetical protein C12D12.1 - Caenorhab... 54 1e-05
gi|19571560|emb|CAD27470.1| SPAPB18E9.04c [Schizosaccharomyces p... 54 1e-05
gi|14253159|emb|CAC39318.1| VMP3 protein [Volvox carteri f. naga... 54 1e-05
gi|7441828|pir||T10737 extensin-like cell wall protein - sea-isl... 54 1e-05
gi|49094796|ref|XP_408859.1| hypothetical protein AN4722.2 [Aspe... 54 2e-05
gi|32566278|ref|NP_500256.2| predicted CDS, putative membrane pr... 54 2e-05
gi|17221116|gb|AAK61485.1| glycoprotein gp2 [Equine herpesvirus 1] 54 2e-05
gi|46123837|ref|XP_386472.1| hypothetical protein FG06296.1 [Gib... 54 2e-05
gi|37962900|gb|AAR05804.1| ICHIT [Anopheles gambiae] 54 2e-05
gi|39579415|emb|CAE56721.1| Hypothetical protein CBG24508 [Caeno... 54 2e-05
gi|42795202|gb|AAS45959.1| envelope glycoprotein [Equine herpesv... 54 2e-05
gi|2224921|gb|AAC47557.1| insect intestinal mucin IIM22 [Trichop... 54 2e-05
gi|37962898|gb|AAR05803.1| ICHIT [Anopheles gambiae] 54 2e-05
gi|17543234|ref|NP_501173.1| putative protein (4I100) [Caenorhab... 54 2e-05
gi|50553414|ref|XP_504118.1| hypothetical protein [Yarrowia lipo... 53 3e-05
gi|50306081|ref|XP_453002.1| unnamed protein product [Kluyveromy... 53 3e-05
gi|37962894|gb|AAR05801.1| ICHIT [Anopheles gambiae] 53 3e-05
gi|119714|sp|P13983|EXTN_TOBAC Extensin precursor (Cell wall hyd... 53 3e-05
gi|37962896|gb|AAR05802.1| ICHIT [Anopheles gambiae] 53 3e-05
gi|49474592|ref|YP_032634.1| hypothetical protein BQ10680 [Barto... 53 3e-05
gi|15022163|gb|AAC49600.2| putative proline-rich protein [Solanu... 53 3e-05
gi|7441829|pir||T09854 proline-rich cell wall protein - upland c... 53 3e-05
gi|38092041|ref|XP_137868.3| similar to proline-rich peptides 63... 53 3e-05
gi|25453525|pir||T52340 cell wall-plasma membrane linker protein... 53 3e-05
gi|38077118|ref|XP_354871.1| similar to sublingual apomucin [Mus... 53 3e-05
gi|46227103|gb|EAK88053.1| large low complexity protein with pro... 53 3e-05
gi|25056007|gb|AAD55980.2| extensin-like protein [Zea mays] 53 4e-05
gi|2224919|gb|AAC47556.1| insect intestinal mucin IIM14 [Trichop... 53 4e-05
gi|24651944|ref|NP_610437.1| CG8181-PA [Drosophila melanogaster]... 53 4e-05
gi|32414167|ref|XP_327563.1| hypothetical protein [Neurospora cr... 53 4e-05
gi|38100339|gb|EAA47477.1| predicted protein [Magnaporthe grisea... 53 4e-05
gi|1079170|pir||S50125 larval glue protein Lgp3 precursor - frui... 53 4e-05
gi|46090783|dbj|BAD13529.1| collagen-binding adhesin [Streptococ... 53 4e-05
gi|31211701|ref|XP_314820.1| ENSANGP00000005139 [Anopheles gambi... 52 5e-05
gi|39597010|emb|CAE59237.1| Hypothetical protein CBG02561 [Caeno... 52 5e-05
gi|1709767|sp|Q00451|PRF1_LYCES 36.4 KD PROLINE-RICH PROTEIN >gn... 52 5e-05
gi|50549375|ref|XP_502158.1| hypothetical protein [Yarrowia lipo... 52 5e-05
gi|24663552|ref|NP_648610.1| CG14120-PA [Drosophila melanogaster... 52 5e-05
gi|19521|emb|CAA40361.1| proline rich protein [Lycopersicon escu... 52 5e-05
gi|41400384|gb|AAS07044.1| plus agglutinin [Chlamydomonas reinha... 52 5e-05
gi|11278205|pir||T45462 membrane glycoprotein [imported] - equin... 52 6e-05
gi|37962892|gb|AAR05800.1| ICHIT [Anopheles gambiae] 52 6e-05
gi|30022968|ref|NP_834599.1| Cell surface protein [Bacillus cere... 52 6e-05
gi|48894683|ref|ZP_00327792.1| COG1530: Ribonucleases G and E [T... 52 6e-05
gi|42519237|ref|NP_965167.1| hypothetical protein LJ1313 [Lactob... 52 6e-05
gi|50257806|gb|EAL20507.1| hypothetical protein CNBE4270 [Crypto... 52 6e-05
gi|50548419|ref|XP_501679.1| hypothetical protein [Yarrowia lipo... 52 6e-05
gi|17568435|ref|NP_508295.1| putative protein family member (XC1... 52 6e-05
gi|17221100|gb|AAK61477.1| glycoprotein gp2 [Equine herpesvirus 1] 52 6e-05
gi|38111325|gb|EAA56921.1| hypothetical protein MG07276.4 [Magna... 52 6e-05
gi|50257374|gb|EAL20083.1| hypothetical protein CNBF4090 [Crypto... 52 6e-05
gi|41400381|gb|AAS07042.1| minus agglutinin [Chlamydomonas reinh... 52 6e-05
gi|25152945|ref|NP_741957.1| carboxyl ester lipase like (XS293) ... 52 8e-05
gi|17569991|ref|NP_510853.1| bile lipase like (XS293) [Caenorhab... 52 8e-05
gi|50744594|ref|XP_419791.1| PREDICTED: similar to Wiskott-Aldri... 52 8e-05
gi|38108069|gb|EAA54157.1| hypothetical protein MG02142.4 [Magna... 52 8e-05
gi|42570779|ref|NP_973463.1| arabinogalactan-protein (AGP9) [Ara... 52 8e-05
gi|17569989|ref|NP_510854.1| carboxyl ester lipase like (XS293) ... 52 8e-05
gi|17569987|ref|NP_510852.1| bile lipase like (XS293) [Caenorhab... 52 8e-05
gi|50549557|ref|XP_502249.1| hypothetical protein [Yarrowia lipo... 52 8e-05
gi|15226024|ref|NP_179095.1| arabinogalactan-protein (AGP9) [Ara... 52 8e-05
gi|13265426|gb|AAG40020.2| At2g14890 [Arabidopsis thaliana] 52 8e-05
gi|32440607|emb|CAA21616.2| Hypothetical protein Y43F8C.16 [Caen... 52 8e-05
gi|27673011|ref|XP_220573.1| similar to platelet glycoprotein Ib... 51 1e-04
gi|6753754|ref|NP_034265.1| enabled homolog; NPC derived proline... 51 1e-04
gi|1644457|gb|AAC52864.1| neural variant mena+ protein [Mus musc... 51 1e-04
gi|42562273|ref|NP_173768.2| protein kinase family protein [Arab... 51 1e-04
gi|24637972|gb|AAN63949.1| peritrophic matrix insect intestinal ... 51 1e-04
gi|25518375|pir||B86369 hypothetical protein F5O8.10 - Arabidops... 51 1e-04
gi|13508191|ref|NP_110140.1| cytadherence accessory protein HMW3... 51 1e-04
gi|28574875|ref|NP_730262.2| CG13731-PA [Drosophila melanogaster... 51 1e-04
gi|19115833|ref|NP_594921.1| actin binding protein with SH3 doma... 51 1e-04
gi|8778584|gb|AAF79592.1| F28C11.17 [Arabidopsis thaliana] 51 1e-04
gi|1644459|gb|AAC52865.1| neural variant mena++ protein [Mus mus... 51 1e-04
gi|15611012|ref|NP_218393.1| hypothetical protein Rv3876 [Mycoba... 51 1e-04
gi|26000243|gb|AAN75564.1| adhesin FhaB [Bordetella avium] 51 1e-04
gi|6958206|gb|AAF32493.1| kexin-like protease KEX1 [Pneumocystis... 51 1e-04
gi|28856212|gb|AAH48067.1| Unknown (protein for IMAGE:3818911) [... 51 1e-04
gi|127354|sp|P09125|MSP8_EIMAC MEROZOITE SURFACE PROTEIN CMZ-8 >... 51 1e-04
gi|11278206|pir||T45463 membrane glycoprotein [imported] - equin... 51 1e-04
gi|39590923|emb|CAE58703.1| Hypothetical protein CBG01887 [Caeno... 51 1e-04
gi|34867741|ref|XP_235593.2| similar to submaxillary apomucin [R... 51 1e-04
gi|120184|sp|P06916|FIRA_PLAFF 300 KD ANTIGEN AG231 >gnl|BL_ORD_... 51 1e-04
gi|50290763|ref|XP_447814.1| unnamed protein product [Candida gl... 51 1e-04
gi|15222649|ref|NP_173940.1| protein kinase family protein [Arab... 51 1e-04
gi|32412728|ref|XP_326844.1| hypothetical protein [Neurospora cr... 51 1e-04
gi|50423327|ref|XP_460246.1| unnamed protein product [Debaryomyc... 50 2e-04
gi|11994465|dbj|BAB02467.1| unnamed protein product [Arabidopsis... 50 2e-04
gi|39583830|emb|CAE74903.1| Hypothetical protein CBG22772 [Caeno... 50 2e-04
gi|30685319|ref|NP_188574.2| late embryogenesis abundant protein... 50 2e-04
gi|282110|pir||C41859 IgA-specific metalloendopeptidase (EC 3.4.... 50 2e-04
gi|1170517|sp|P45386|IGA4_HAEIN Immunoglobulin A1 protease precu... 50 2e-04
gi|34534555|dbj|BAC87042.1| unnamed protein product [Homo sapiens] 50 2e-04
gi|45454232|gb|AAS65795.1| putative protein kinase [Arabidopsis ... 50 2e-04
gi|19553263|ref|NP_601265.1| signal recognition particle GTPase ... 50 2e-04
gi|50548263|ref|XP_501601.1| hypothetical protein [Yarrowia lipo... 50 2e-04
gi|7486419|pir||T04455 hypothetical protein F4D11.90 - Arabidops... 50 2e-04
gi|17221112|gb|AAK61483.1| glycoprotein gp2 [Equine herpesvirus 1] 50 2e-04
gi|17221102|gb|AAK61478.1| glycoprotein gp2 [Equine herpesvirus 1] 50 2e-04
gi|15242165|ref|NP_196996.1| gibberellin-regulated family protei... 50 2e-04
gi|29830947|ref|NP_825581.1| hypothetical protein SAV4404 [Strep... 50 2e-04
gi|27479897|ref|XP_210394.1| similar to Contains similarity to e... 50 2e-04
gi|38108532|gb|EAA54535.1| hypothetical protein MG02520.4 [Magna... 50 2e-04
gi|1082604|pir||S53363 mucin 5AC (clone JER58) - human (fragment... 50 2e-04
gi|29377839|ref|NP_816967.1| cell wall surface anchor signal pro... 50 2e-04
gi|7446926|pir||S72384 hypothetical protein 8 precursor - Entero... 50 2e-04
gi|29826652|ref|NP_821286.1| hypothetical protein SAV112 [Strept... 50 3e-04
gi|41326238|emb|CAF20400.1| Signal recognition particle GTPase [... 50 3e-04
gi|19424152|ref|NP_598197.1| mucin 10 [Rattus norvegicus] >gnl|B... 50 3e-04
gi|7484956|pir||T01456 extensin homolog F24O1.18 - Arabidopsis t... 50 3e-04
gi|15220780|ref|NP_176434.1| leucine-rich repeat family protein ... 50 3e-04
gi|18025490|gb|AAK95434.1| gp350 [cercopithicine herpesvirus 15] 50 3e-04
gi|544262|sp|Q03211|EXLP_TOBAC Pistil-specific extensin-like pro... 50 3e-04
gi|16554072|dbj|BAB71645.1| unnamed protein product [Homo sapiens] 50 3e-04
gi|134786|sp|P10667|MUA1_XENLA Integumentary mucin A.1 precursor... 50 3e-04
gi|38099936|gb|EAA47184.1| hypothetical protein MG11009.4 [Magna... 50 3e-04
gi|21324832|dbj|BAB99455.1| Signal recognition particle GTPase [... 50 3e-04
gi|40255220|ref|NP_848547.2| similar to RIKEN cDNA 4930457P18 [H... 50 3e-04
gi|22125449|ref|NP_668872.1| hypothetical [Yersinia pestis KIM] ... 50 3e-04
gi|11968243|ref|NP_072030.1| cell wall anchoring protein [Entero... 50 3e-04
gi|25404769|pir||H96711 hypothetical protein F14K14.17 [imported... 49 4e-04
gi|22330504|ref|NP_177041.2| arabinogalactan-protein, putative (... 49 4e-04
gi|31207057|ref|XP_312495.1| ENSANGP00000022047 [Anopheles gambi... 49 4e-04
gi|17221114|gb|AAK61484.1| glycoprotein gp2 [Equine herpesvirus 1] 49 4e-04
gi|25027684|ref|NP_737738.1| hypothetical protein [Corynebacteri... 49 4e-04
gi|2827460|gb|AAC39773.1| hepatitis A virus cellular receptor 1 ... 49 4e-04
gi|2827456|gb|AAC39771.1| hepatitis A virus cellular receptor 1 ... 49 4e-04
gi|2827462|gb|AAC39774.1| hepatitis A virus cellular receptor 1 ... 49 4e-04
gi|46397621|sp|P98088|MU5A_HUMAN Mucin 5AC (Mucin 5 subtype AC, ... 49 4e-04
gi|46228470|gb|EAK89340.1| uncharacterized protein with threonin... 49 4e-04
gi|2827458|gb|AAC39772.1| hepatitis A virus cellular receptor 1 ... 49 4e-04
gi|17384258|emb|CAC83676.1| mucin 5 [Homo sapiens] 49 4e-04
gi|25518689|pir||G86292 hypothetical protein F7H2.17 [imported] ... 49 4e-04
gi|25402610|pir||G86239 protein F20B24.6 [imported] - Arabidopsi... 49 5e-04
gi|14571744|emb|CAC42801.1| probable protease 1 like protein [Pn... 49 5e-04
gi|24647644|ref|NP_650611.1| CG4090-PA [Drosophila melanogaster]... 49 5e-04
gi|6754038|ref|NP_034456.1| glycoprotein 1b, alpha polypeptide [... 49 5e-04
gi|15223161|ref|NP_177203.1| protein kinase, putative [Arabidops... 49 5e-04
gi|15218591|ref|NP_172532.1| protein kinase family protein [Arab... 49 5e-04
gi|17221098|gb|AAK61476.1| glycoprotein gp2 [Equine herpesvirus 1] 49 5e-04
gi|9049516|gb|AAF82403.1| mucin 1 [Macaca mulatta] 49 7e-04
gi|34878775|ref|XP_222503.2| similar to Tumor necrosis factor re... 49 7e-04
gi|46365146|ref|ZP_00227658.1| COG0515: Serine/threonine protein... 49 7e-04
gi|27881486|ref|NP_775078.1| zonadhesin isoform 1 [Homo sapiens]... 49 7e-04
gi|15721995|gb|AAL04410.1| zonadhesin splice variant 1 [Homo sap... 49 7e-04
gi|27881490|ref|NP_775080.1| zonadhesin isoform 4 [Homo sapiens]... 49 7e-04
gi|15721999|gb|AAL04414.1| zonadhesin splice variant 4 [Homo sap... 49 7e-04
gi|27881494|ref|NP_775082.1| zonadhesin isoform 6 [Homo sapiens]... 49 7e-04
gi|15721998|gb|AAL04413.1| zonadhesin splice variant 6 [Homo sap... 49 7e-04
gi|29374803|ref|NP_813955.1| cell wall surface anchor family pro... 49 7e-04
gi|32417598|ref|XP_329277.1| predicted protein [Neurospora crass... 49 7e-04
gi|16554449|ref|NP_003377.1| zonadhesin isoform 3 [Homo sapiens]... 49 7e-04
gi|27924006|sp|Q9Y493|ZAN_HUMAN Zonadhesin precursor >gnl|BL_ORD... 49 7e-04
gi|21592790|gb|AAM64739.1| unknown [Arabidopsis thaliana] 49 7e-04
gi|30984464|ref|NP_851896.1| very large tegument protein [Cercop... 49 7e-04
gi|24646975|ref|NP_650420.1| CG3984-PA [Drosophila melanogaster]... 49 7e-04
gi|49117362|gb|AAH72701.1| Unknown (protein for IMAGE:7001487) [... 49 7e-04
gi|2276127|dbj|BAA21556.1| hepatitis A virus receptor [Cercopith... 49 7e-04
gi|20128875|ref|NP_569927.1| CG14796-PA [Drosophila melanogaster... 49 7e-04
gi|15722000|gb|AAL04415.1| zonadhesin splice variant 2 [Homo sap... 49 7e-04
gi|27881488|ref|NP_775079.1| zonadhesin isoform 2 [Homo sapiens]... 49 7e-04
gi|1372954|gb|AAB02122.1| 230 kDa protein 49 7e-04
gi|32408995|ref|XP_324978.1| predicted protein [Neurospora crass... 49 7e-04
gi|50313312|ref|YP_053115.1| membrane glycoprotein [Equine herpe... 49 7e-04
gi|27881492|ref|NP_775081.1| zonadhesin isoform 5 [Homo sapiens]... 49 7e-04
gi|15721997|gb|AAL04412.1| zonadhesin splice variant 5 [Homo sap... 49 7e-04
gi|14150039|ref|NP_115667.1| hypothetical protein DKFZp761D221 [... 48 9e-04
gi|423830|pir||A45690 transactivator EBNA-2 - baboon lymphotropi... 48 9e-04
gi|39581621|emb|CAE58406.1| Hypothetical protein CBG01536 [Caeno... 48 9e-04
gi|13095628|ref|NP_076543.1| glycoprotein gp80 [Bovine herpesvir... 48 9e-04
gi|11346533|pir||T44657 protein GP80 [imported] - bovine herpesv... 48 9e-04
gi|41151211|ref|XP_372874.1| similar to salivary proline-rich pr... 48 9e-04
gi|41150903|ref|XP_374359.1| hypothetical protein XP_379750 [Hom... 48 9e-04
gi|47522531|dbj|BAD20200.1| keratin associated protein [Homo sap... 48 9e-04
gi|3135306|gb|AAC78790.1| zonadhesin [Homo sapiens] 48 9e-04
gi|17221104|gb|AAK61479.1| glycoprotein gp2 [Equine herpesvirus 1] 48 9e-04
gi|46433992|gb|EAK93415.1| hypothetical protein CaO19.207 [Candi... 48 9e-04
gi|103873|pir||JX0092 apopolysialoglycoprotein - cherry salmon >... 48 9e-04
gi|38345019|emb|CAD41511.2| OSJNBa0029H02.3 [Oryza sativa (japon... 48 9e-04
gi|11360494|pir||T44768 antifreeze glycopeptide AFGP polyprotein... 48 9e-04
gi|49120840|ref|XP_412378.1| hypothetical protein AN8241.2 [Aspe... 48 9e-04
gi|33286442|ref|NP_068765.2| BCL6 co-repressor-like 1 [Homo sapi... 48 0.001
gi|42565109|ref|NP_188851.2| protease inhibitor/seed storage/lip... 48 0.001
gi|14599404|emb|CAC43457.1| protease 1 [Pneumocystis carinii] 48 0.001
gi|18447198|gb|AAL68190.1| GH09355p [Drosophila melanogaster] 48 0.001
gi|34881078|ref|XP_341166.1| similar to mena protein [Rattus nor... 48 0.001
gi|2147979|pir||S66275 proline-rich protein - Solanum brevidens ... 48 0.001
gi|1076501|pir||S52985 cell wall protein - alfalfa >gnl|BL_ORD_I... 48 0.001
gi|17550356|ref|NP_508602.1| putative secreted or extracellular ... 48 0.001
gi|47522529|dbj|BAD20199.1| keratin associated protein [Homo sap... 48 0.001
gi|47027974|gb|AAT09005.1| UHS KerB-like [Homo sapiens] 48 0.001
gi|3068553|gb|AAC14361.1| glycoprotein Ib [Canis familiaris] 48 0.001
gi|24662885|ref|NP_648504.1| CG6004-PB [Drosophila melanogaster]... 48 0.001
gi|50553536|ref|XP_504179.1| hypothetical protein [Yarrowia lipo... 48 0.001
gi|18676526|dbj|BAB84915.1| FLJ00160 protein [Homo sapiens] 48 0.001
gi|15235186|ref|NP_195123.1| leucine-rich repeat family protein ... 48 0.001
gi|42820330|emb|CAF31638.1| keratin associated protein 5-9 [Homo... 48 0.001
gi|17221106|gb|AAK61480.1| glycoprotein gp2 [Equine herpesvirus 1] 48 0.001
gi|42525075|ref|NP_970455.1| hypothetical protein Bd3745 [Bdello... 48 0.001
gi|50287949|ref|XP_446403.1| unnamed protein product [Candida gl... 48 0.001
gi|38103658|gb|EAA50334.1| hypothetical protein MG04093.4 [Magna... 47 0.002
gi|24650473|ref|NP_651520.1| CG6296-PA [Drosophila melanogaster]... 47 0.002
gi|20847965|ref|XP_150039.1| hypothetical protein XP_150039 [Mus... 47 0.002
gi|50549423|ref|XP_502182.1| hypothetical protein [Yarrowia lipo... 47 0.002
gi|46123979|ref|XP_386543.1| hypothetical protein FG06367.1 [Gib... 47 0.002
gi|323142|pir||A45559 sporozoite surface protein 2 - Plasmodium ... 47 0.002
gi|42630174|ref|ZP_00155718.1| COG3468: Type V secretory pathway... 47 0.002
gi|45190779|ref|NP_985033.1| AER176Wp [Eremothecium gossypii] >g... 47 0.002
gi|45645179|sp|Q01443|SSP2_PLAYO Sporozoite surface protein 2 pr... 47 0.002
gi|2327063|gb|AAB66702.1| protease 1 [Pneumocystis carinii f. sp... 47 0.002
gi|46202034|ref|ZP_00053896.2| COG2885: Outer membrane protein a... 47 0.002
gi|50542920|ref|XP_499626.1| hypothetical protein [Yarrowia lipo... 47 0.002
gi|7657283|ref|NP_056623.1| keratin associated protein 5-1; kera... 47 0.002
gi|12697907|dbj|BAB21772.1| KIAA1681 protein [Homo sapiens] 47 0.002
gi|45550540|ref|NP_647904.2| CG11345-PA [Drosophila melanogaster... 47 0.002
gi|21693269|gb|AAM75216.1| EF0010 [Enterococcus faecalis] 47 0.002
gi|20138131|sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1... 47 0.002
gi|39578750|emb|CAE57157.1| Hypothetical protein CBG25091 [Caeno... 47 0.002
gi|37515402|emb|CAE48361.1| RAPH1 protein [Homo sapiens] 47 0.002
gi|47132519|ref|NP_998754.1| Ras association and pleckstrin homo... 47 0.002
gi|16418401|ref|NP_443120.1| KIAA0563-related gene [Homo sapiens... 47 0.002
gi|15805962|ref|NP_294662.1| hypothetical protein [Deinococcus r... 47 0.002
gi|584904|sp|P37697|CCPA_ACEXY Cellulose complementing protein >... 47 0.002
gi|49087246|ref|XP_405580.1| hypothetical protein AN1443.2 [Aspe... 47 0.002
gi|39579244|emb|CAE56974.1| Hypothetical protein CBG24827 [Caeno... 47 0.002
gi|29375118|ref|NP_814271.1| cell wall surface anchor family pro... 47 0.002
gi|32414489|ref|XP_327724.1| hypothetical protein [Neurospora cr... 47 0.002
gi|46108228|ref|XP_381172.1| hypothetical protein FG00996.1 [Gib... 47 0.002
gi|50591074|ref|ZP_00332403.1| COG4932: Predicted outer membrane... 47 0.002
gi|31200811|ref|XP_309353.1| ENSANGP00000015008 [Anopheles gambi... 47 0.002
gi|15233717|ref|NP_193252.1| protease inhibitor/seed storage/lip... 47 0.002
gi|17221110|gb|AAK61482.1| glycoprotein gp2 [Equine herpesvirus 1] 47 0.002
gi|995765|gb|AAA75589.1| mucin 47 0.003
gi|46134181|ref|XP_389406.1| hypothetical protein FG09230.1 [Gib... 47 0.003
gi|27375632|ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum U... 47 0.003
gi|46164968|ref|ZP_00138044.2| hypothetical protein Paer022183 [... 47 0.003
gi|628967|pir||S45091 hypothetical protein iota - Streptococcus ... 47 0.003
gi|49080520|ref|XP_403769.1| hypothetical protein UM06154.1 [Ust... 47 0.003
gi|46906558|ref|YP_012947.1| cell wall surface anchor family pro... 47 0.003
gi|28481020|ref|XP_129972.3| similar to Zinc finger, CCHC domain... 47 0.003
gi|50511081|dbj|BAD32526.1| mKIAA1744 protein [Mus musculus] 47 0.003
gi|27817931|dbj|BAC55695.1| putative diaphanous homologue [Oryza... 47 0.003
gi|50258767|gb|EAL21452.1| hypothetical protein CNBD1470 [Crypto... 47 0.003
gi|26331946|dbj|BAC29703.1| unnamed protein product [Mus musculus] 47 0.003
gi|34872040|ref|XP_342942.1| similar to UROMODULIN PRECURSOR (TA... 47 0.003
gi|322759|pir||PQ0479 pistil extensin-like protein (clone pMG14)... 47 0.003
gi|7512244|pir||S71754 cellular hepatitis A receptor HAVcr-1 pre... 47 0.003
gi|25152063|ref|NP_509435.2| putative protein, with 2 coiled coi... 47 0.003
gi|31795053|ref|NP_857546.1| HYPOTHETICAL ALANINE AND PROLINE RI... 46 0.003
gi|22970204|ref|ZP_00017330.1| hypothetical protein [Chloroflexu... 46 0.003
gi|2077900|dbj|BAA19915.1| flocculin [Saccharomyces cerevisiae] 46 0.003
gi|17566088|ref|NP_507521.1| putative protein (5S487) [Caenorhab... 46 0.003
gi|6678962|ref|NP_032670.1| mucin 10 [Mus musculus] >gnl|BL_ORD_... 46 0.003
gi|32423161|ref|XP_332018.1| hypothetical protein [Neurospora cr... 46 0.003
gi|7494070|pir||S20074 promastigote surface antigen P2 (clone 4.... 46 0.003
gi|50255356|gb|EAL18091.1| hypothetical protein CNBK1120 [Crypto... 46 0.003
gi|48847365|ref|ZP_00301621.1| COG4932: Predicted outer membrane... 46 0.003
gi|48763011|ref|ZP_00267568.1| COG1426: Uncharacterized protein ... 46 0.003
gi|22299765|ref|NP_683012.1| serine/threonine protein kinase [Th... 46 0.003
gi|49087830|ref|XP_405807.1| hypothetical protein AN1670.2 [Aspe... 46 0.003
gi|31217486|ref|XP_316436.1| ENSANGP00000020475 [Anopheles gambi... 46 0.003
gi|17221108|gb|AAK61481.1| glycoprotein gp2 [Equine herpesvirus 1] 46 0.003
gi|32422095|ref|XP_331491.1| predicted protein [Neurospora crass... 46 0.003
gi|39936950|ref|NP_949226.1| unknown protein [Rhodopseudomonas p... 46 0.003
gi|17510531|ref|NP_491042.1| putative protein family member (1D3... 46 0.003
gi|629892|pir||JC2301 hypothetical 47.8K protein - Pneumocystis ... 46 0.003
gi|49478820|ref|YP_038951.1| conserved hypothetical protein, pos... 46 0.003
gi|49093892|ref|XP_408407.1| hypothetical protein AN4270.2 [Aspe... 46 0.004
gi|34223136|sp|Q9C0B9|ZCH2_HUMAN Zinc finger CCHC domain contain... 46 0.004
gi|125681|sp|P26371|KRUA_HUMAN Keratin, ultra high-sulfur matrix... 46 0.004
gi|25029366|ref|NP_739420.1| conserved hypothetical protein [Cor... 46 0.004
gi|50421125|ref|XP_459108.1| unnamed protein product [Debaryomyc... 46 0.004
gi|46128557|ref|XP_388832.1| hypothetical protein FG08656.1 [Gib... 46 0.004
gi|42567033|ref|NP_193978.2| protease inhibitor/seed storage/lip... 46 0.004
gi|12698033|dbj|BAB21835.1| KIAA1744 protein [Homo sapiens] 46 0.004
gi|18403249|ref|NP_566698.1| proline-rich family protein [Arabid... 46 0.004
gi|49106150|ref|XP_411399.1| hypothetical protein AN7262.2 [Aspe... 46 0.004
gi|3335680|gb|AAC27329.1| hyosophorin [Cyprinus carpio] 46 0.004
gi|15222149|ref|NP_175372.1| leucine-rich repeat family protein ... 46 0.004
gi|41872709|ref|NP_060212.3| zinc finger, CCHC domain containing... 46 0.004
gi|119713|sp|P24152|EXTN_SORBI Extensin precursor (Proline-rich ... 46 0.004
gi|7446489|pir||T05441 proline-rich protein F7K2.50 - Arabidopsi... 46 0.004
gi|33300082|emb|CAE17706.1| Hypothetical protein C30H6.11 [Caeno... 46 0.004
gi|46437620|gb|EAK96963.1| hypothetical protein CaO19.9736 [Cand... 46 0.004
gi|38105533|gb|EAA51950.1| hypothetical protein MG03545.4 [Magna... 45 0.006
gi|46431621|gb|EAK91163.1| hypothetical protein CaO19.4555 [Cand... 45 0.006
gi|39583863|emb|CAE63953.1| Hypothetical protein CBG08535 [Caeno... 45 0.006
gi|81286|pir||S22697 extensin - Volvox carteri (fragment) >gnl|B... 45 0.006
gi|32421735|ref|XP_331311.1| hypothetical protein [Neurospora cr... 45 0.006
gi|40788304|dbj|BAA31593.2| KIAA0618 protein [Homo sapiens] 45 0.006
gi|17384256|emb|CAC83675.1| mucin 5 [Homo sapiens] 45 0.006
gi|8515090|gb|AAF75821.1| putative arabinogalactan protein [Pinu... 45 0.006
gi|30179887|sp|Q06561|UN52_CAEEL Basement membrane proteoglycan ... 45 0.006
gi|28950292|emb|CAD70746.1| related to DNA-dependent ATPase DOMI... 45 0.006
gi|32563835|ref|NP_497044.2| perlecan, basement membrane heparan... 45 0.006
gi|871535|emb|CAA61073.1| verprolin [Saccharomyces cerevisiae] 45 0.006
gi|6323370|ref|NP_013441.1| Involved in cytoskeletal organizatio... 45 0.006
gi|31204765|ref|XP_311331.1| ENSANGP00000001657 [Anopheles gambi... 45 0.006
gi|13472161|ref|NP_103728.1| serine/threonine kinase [Mesorhizob... 45 0.006
gi|1931637|gb|AAB65472.1| receptor-associated kinase isolog; 302... 45 0.006
gi|26051278|ref|NP_742017.1| nuclear pore membrane protein 121; ... 45 0.006
gi|14571747|emb|CAC42804.1| possible protease I [Pneumocystis ca... 45 0.006
gi|38105585|gb|EAA51996.1| predicted protein [Magnaporthe grisea... 45 0.008
gi|17539380|ref|NP_501263.1| putative protein (4I491) [Caenorhab... 45 0.008
gi|22135894|gb|AAM91529.1| unknown protein [Arabidopsis thaliana] 45 0.008
gi|22327039|ref|NP_197859.2| WD-40 repeat family protein [Arabid... 45 0.008
gi|48891739|ref|ZP_00325205.1| COG2931: RTX toxins and related C... 45 0.008
gi|47573261|ref|ZP_00243300.1| COG0810: Periplasmic protein TonB... 45 0.008
gi|106253|pir||S18946 ultra high-sulfur keratin 1 - human >gnl|B... 45 0.008
gi|46363288|ref|ZP_00226055.1| COG3391: Uncharacterized conserve... 45 0.008
gi|32420163|ref|XP_330525.1| predicted protein [Neurospora crass... 45 0.008
gi|46116158|ref|XP_384097.1| hypothetical protein FG03921.1 [Gib... 45 0.008
gi|21592647|gb|AAM64596.1| unknown [Arabidopsis thaliana] 45 0.008
gi|50408999|ref|XP_456829.1| unnamed protein product [Debaryomyc... 45 0.008
gi|46115698|ref|XP_383867.1| hypothetical protein FG03691.1 [Gib... 45 0.008
gi|34223444|gb|AAQ62965.1| UHS KERB-like protein [Homo sapiens] 45 0.008
gi|42821121|ref|NP_005544.3| keratin, cuticle, ultrahigh sulphur... 45 0.008
gi|205686|gb|AAA41695.1| heavy neurofilament subunit 45 0.008
gi|41149762|ref|XP_370693.1| POU domain, class 6, transcription ... 45 0.008
gi|15235668|ref|NP_193070.1| leucine-rich repeat family protein ... 45 0.008
gi|23127449|ref|ZP_00109318.1| hypothetical protein [Nostoc punc... 45 0.008
gi|24571163|gb|AAN62896.1| cell wall protein; Sed1p [Saccharomyc... 45 0.008
gi|100753|pir||S13383 hydroxyproline-rich glycoprotein - sorghum... 45 0.008
gi|9759211|dbj|BAB09653.1| unnamed protein product [Arabidopsis ... 45 0.008
gi|37805990|dbj|BAC99403.1| putative diaphanous 1 [Oryza sativa ... 45 0.008
gi|439289|emb|CAA81388.1| verprolin [Saccharomyces cerevisiae] 45 0.008
gi|31414574|dbj|BAC58076.2| large tegument protein [Cercopitheci... 45 0.008
gi|38100349|gb|EAA47486.1| hypothetical protein MG02729.4 [Magna... 45 0.008
gi|1184100|gb|AAA87047.1| pistil extensin-like protein 45 0.008
gi|30802079|gb|AAH51326.1| POU6F1 protein [Homo sapiens] 45 0.008
gi|47230306|emb|CAG10720.1| unnamed protein product [Tetraodon n... 45 0.008
gi|50305509|ref|XP_452714.1| unnamed protein product [Kluyveromy... 45 0.010
gi|15242969|ref|NP_200624.1| formin homology 2 domain-containing... 45 0.010
gi|18025476|gb|AAK95420.1| BPLF1 [cercopithicine herpesvirus 15] 45 0.010
gi|7511432|pir||T21460 hypothetical protein ZK945.10 - Caenorhab... 45 0.010
gi|41053475|ref|NP_956982.1| hypothetical protein MGC64189 [Dani... 45 0.010
gi|47214483|emb|CAG12488.1| unnamed protein product [Tetraodon n... 45 0.010
gi|50553722|ref|XP_504272.1| hypothetical protein [Yarrowia lipo... 45 0.010
gi|24571166|gb|AAN62897.1| cell wall protein; Sed1p [Saccharomyc... 45 0.010
gi|39593504|emb|CAE61796.1| Hypothetical protein CBG05759 [Caeno... 45 0.010
gi|17535137|ref|NP_496184.1| location Of Vulva defective LOV-1, ... 45 0.010
gi|39583089|emb|CAE60629.1| Hypothetical protein CBG04272 [Caeno... 45 0.010
gi|37520001|ref|NP_923378.1| unknown protein [Gloeobacter violac... 45 0.010
gi|17939907|emb|CAD19511.1| UL36 protein [Suid herpesvirus 1 str... 45 0.010
gi|32418914|ref|XP_329935.1| hypothetical protein [Neurospora cr... 45 0.010
gi|32415613|ref|XP_328285.1| predicted protein [Neurospora crass... 45 0.010
gi|585527|sp|Q05049|MUC1_XENLA Integumentary mucin C.1 (FIM-C.1)... 45 0.010
gi|10048477|ref|NP_035871.1| zonadhesin [Mus musculus] >gnl|BL_O... 44 0.013
gi|46109290|ref|XP_381703.1| hypothetical protein FG01527.1 [Gib... 44 0.013
gi|111979|pir||A39321 mucin - rat (fragment) >gnl|BL_ORD_ID|6277... 44 0.013
gi|46109412|ref|XP_381764.1| hypothetical protein FG01588.1 [Gib... 44 0.013
gi|10567824|ref|NP_066384.1| keratin, ultrahigh sulfur, B; UHS K... 44 0.013
gi|15805485|ref|NP_294181.1| hypothetical protein [Deinococcus r... 44 0.013
gi|5917664|gb|AAD55979.1| extensin-like protein [Lycopersicon es... 44 0.013
gi|38490583|ref|NP_941968.1| keratin associated protein 10-8; ke... 44 0.013
gi|38490579|ref|NP_941965.1| keratin associated protein 10-11; k... 44 0.013
gi|38106890|gb|EAA53137.1| hypothetical protein MG07414.4 [Magna... 44 0.013
gi|1076237|pir||S52994 arabinogalactan-like protein - loblolly p... 44 0.013
gi|23483516|gb|EAA19160.1| Drosophila melanogaster CG5228 gene p... 44 0.013
gi|48130453|ref|XP_393317.1| similar to ENSANGP00000006359 [Apis... 44 0.013
gi|34903544|ref|NP_913119.1| putative protein kinase APK1AArabid... 44 0.013
gi|34879775|ref|XP_228795.2| similar to CG32602-PA [Rattus norve... 44 0.013
gi|15609219|ref|NP_216598.1| hypothetical protein Rv2082 [Mycoba... 44 0.013
gi|31793265|ref|NP_855758.1| CONSERVED HYPOTHETICAL PROTEIN [Myc... 44 0.013
gi|47522539|dbj|BAD20204.1| keratin associated protein [Homo sap... 44 0.013
gi|7499248|pir||T25697 hypothetical protein F16F9.2 - Caenorhabd... 44 0.013
gi|24571155|gb|AAN62893.1| cell wall protein; Sed1p [Saccharomyc... 44 0.013
gi|188874|gb|AAA36334.1| intestinal mucin 44 0.013
gi|12834988|dbj|BAB23112.1| unnamed protein product [Mus musculus] 44 0.013
gi|31203355|ref|XP_310626.1| ENSANGP00000020758 [Anopheles gambi... 44 0.013
gi|7489086|pir||T10741 extensin-like protein PRP5 - Persian toba... 44 0.013
gi|31217881|ref|XP_316525.1| ENSANGP00000013526 [Anopheles gambi... 44 0.013
gi|24571157|gb|AAN62894.1| cell wall protein; Sed1p [Saccharomyc... 44 0.017
gi|21242846|ref|NP_642428.1| ribonuclease E [Xanthomonas axonopo... 44 0.017
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand... 44 0.017
gi|49097622|ref|XP_410271.1| hypothetical protein AN6134.2 [Aspe... 44 0.017
gi|27552774|gb|AAH42902.1| Muc10 protein [Mus musculus] 44 0.017
gi|34857972|ref|XP_342282.1| mucin1 [Rattus norvegicus] 44 0.017
gi|49091634|ref|XP_407278.1| hypothetical protein AN3141.2 [Aspe... 44 0.017
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand... 44 0.017
gi|24571169|gb|AAN62898.1| cell wall protein; Sed1p [Saccharomyc... 44 0.017
gi|15222464|ref|NP_174461.1| formin homology 2 domain-containing... 44 0.017
gi|50556390|ref|XP_505603.1| hypothetical protein [Yarrowia lipo... 44 0.017
gi|6691467|dbj|BAA89307.1| AHM1 [Triticum aestivum] 44 0.017
gi|39586435|emb|CAE74094.1| Hypothetical protein CBG21754 [Caeno... 44 0.017
gi|27379673|ref|NP_771202.1| blr4562 [Bradyrhizobium japonicum U... 44 0.017
gi|38490577|ref|NP_941963.1| keratin associated protein 10-9; ke... 44 0.017
gi|38258233|sp|Q9BYQ8|KR49_HUMAN Keratin associated protein 4-9 ... 44 0.017
gi|47091457|ref|ZP_00229254.1| cell wall surface anchor family p... 44 0.017
gi|47123082|gb|AAH70750.1| MGC83760 protein [Xenopus laevis] 44 0.017
gi|15609401|ref|NP_216780.1| hypothetical protein Rv2264c [Mycob... 44 0.017
gi|15219860|ref|NP_176303.1| proline-rich family protein [Arabid... 44 0.017
gi|39594650|emb|CAE72228.1| Hypothetical protein CBG19340 [Caeno... 44 0.017
gi|7504248|pir||T22696 hypothetical protein F55B11.3 - Caenorhab... 44 0.017
gi|47215388|emb|CAG02204.1| unnamed protein product [Tetraodon n... 44 0.017
>gi|17557095|ref|NP_499698.1| polycystic kidney disease 1-like 3 (77.8
kD) (3O74) [Caenorhabditis elegans]
gi|7510861|pir||T27642 hypothetical protein ZK1010.5 - Caenorhabditis
elegans
gi|3881478|emb|CAB04971.1| Hypothetical protein ZK1010.5
[Caenorhabditis elegans]
Length = 756
Score = 967 bits (2499), Expect = 0.0
Identities = 542/795 (68%), Positives = 542/795 (68%), Gaps = 51/795 (6%)
Frame = -1
Query: 2271 MRSFRLCQLLLITFFLHQAVGQREVYERYPDSVGRVKRYELWSXXXXXXXXXXXXXXXXX 2092
MRSFRLCQLLLITFFLHQAVGQREVYERYPDSVGRVKRYELWS
Sbjct: 1 MRSFRLCQLLLITFFLHQAVGQREVYERYPDSVGRVKRYELWSNDDGNGVGDGNDDGTGA 60
Query: 2091 XXXXXXDPSPNAGVPSNGTQSDPAGDGSMNKANTTTADSNGSLNPDDGDGKSLLTDRNST 1912
DPSPNAGVPSNGTQSDPAGDGSMNKANTTTADSNGSLNPDDGDGKSLLTDRNST
Sbjct: 61 GQDDDADPSPNAGVPSNGTQSDPAGDGSMNKANTTTADSNGSLNPDDGDGKSLLTDRNST 120
Query: 1911 TSSDGGDPKPVTAKDPSTTTTDQDGLANGDGKPLSTEGTNTTTAXXXXXXXXXXXXXXXX 1732
TSSDGGDPKPVTAKDPSTTTTDQDGLANGDGKPLSTEGTNTTTA
Sbjct: 121 TSSDGGDPKPVTAKDPSTTTTDQDGLANGDGKPLSTEGTNTTTASPNGSLNPDDDDDGLP 180
Query: 1731 XXXXXXGXXXXXXXXXXXAPDSNGLLIPNDKGDNXXXXXXXXXXXXXSDGSLNPDDDNGX 1552
G APDSNGLLIPNDKGDN SDGSLNPDDDNG
Sbjct: 181 NVGDDDGKSSSANKTSTTAPDSNGLLIPNDKGDNSSSTEKTSTTTPASDGSLNPDDDNGT 240
Query: 1551 XXXXXXXXXXTPAADEPLNLDGGDPKPATMKESNTTADXXXXXXXXXXXXVLATSEEPND 1372
TPAADEPLNLDGGDPKPATMKESNTTAD VLATSEEPND
Sbjct: 241 SSFTNKTSTTTPAADEPLNLDGGDPKPATMKESNTTADPVVLTNPPVVVPVLATSEEPND 300
Query: 1371 TTAAPVMPPNPPVGISGPATSEEXXXXXXXXXXXTDLPVVFVDPATSQEPNDTTAAXXXX 1192
TTAAPVMPPNPPVGISGPATSEE TDLPVVFVDPATSQEPNDTTAA
Sbjct: 301 TTAAPVMPPNPPVGISGPATSEEPNNTTAAPTVPTDLPVVFVDPATSQEPNDTTAAPVMP 360
Query: 1191 XXXXXVISGPATSEEPNDTTAAPIMPPNPPVVISGPATSEEPNNTTVAQVMPPNPPVVIV 1012
VISGPATSEEPNDTTAAPIMPPNPPVVISGPATSEEPNNTTVAQVMPPNPPVVIV
Sbjct: 361 PNPPVVISGPATSEEPNDTTAAPIMPPNPPVVISGPATSEEPNNTTVAQVMPPNPPVVIV 420
Query: 1011 DPATSEEPNDTTXXXXXXXXXXXVISGPATSEEPNNTTVAQVMPPNPPVVIVDPATSEEP 832
DPATSEEPNDTT VISGPATSEEPNNTTVAQVMPPNPPVVIVDPATSEEP
Sbjct: 421 DPATSEEPNDTTVAPVMPPNPPVVISGPATSEEPNNTTVAQVMPPNPPVVIVDPATSEEP 480
Query: 831 NDTTVAQVMPPNPPVVIVDPATSEEPNDTTVAQVMPPNPPVVISGPATAKDPSTTTSDPV 652
NDTTVAQVMPPNPPVVIVDPATSEEPNDTTVAQVMPPNPPVVISGPATAKDPSTTTSDPV
Sbjct: 481 NDTTVAQVMPPNPPVVIVDPATSEEPNDTTVAQVMPPNPPVVISGPATAKDPSTTTSDPV 540
Query: 651 VQTNPPVVIVDPATSEEPLST--------------------------------------- 589
VQTNPPVVIVDPATSEEPLST
Sbjct: 541 VQTNPPVVIVDPATSEEPLSTASTALPDETTDAPEEPATEVPNPQPPSPPSPEPEPEPKS 600
Query: 588 ------------ASTALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVTDGP 445
STAL
Sbjct: 601 TPEPVTDGPNESQSTAL------------------------------------------- 617
Query: 444 NESQSTALPQQTTDAPVDPVTEAXXXXXXXXXXXXXXXXXXXXXXXXXXXPKNETVDPVH 265
PQQTTDAPVDPVTEA PKNETVDPVH
Sbjct: 618 --------PQQTTDAPVDPVTEASPLNPQPPPPPSPSPEPEPEPKPPVTPPKNETVDPVH 669
Query: 264 ENGTSGEKDGTPEAQPLKSSSNKKTQAEKDEEELKKRVFAAELGTGSVLVATSIAAYVAS 85
ENGTSGEKDGTPEAQPLKSSSNKKTQAEKDEEELKKRVFAAELGTGSVLVATSIAAYVAS
Sbjct: 670 ENGTSGEKDGTPEAQPLKSSSNKKTQAEKDEEELKKRVFAAELGTGSVLVATSIAAYVAS 729
Query: 84 YMAYTYVKKVAELSV 40
YMAYTYVKKVAELSV
Sbjct: 730 YMAYTYVKKVAELSV 744