Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK1240_4
(915 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|32564318|ref|NP_494239.2| zn-finger, RING and Zn-finger, B-bo... 595 e-169
gi|25395432|pir||H88071 protein ZK1240.3 [imported] - Caenorhabd... 550 e-155
gi|17538071|ref|NP_494242.1| zn-finger, RING and Zn-finger, B-bo... 248 1e-64
gi|17531269|ref|NP_494234.1| predicted CDS, RING zinc finger con... 196 6e-49
gi|25395437|pir||D88072 protein ZK1240.1 [imported] - Caenorhabd... 193 4e-48
gi|32564312|ref|NP_494243.2| zn-finger, RING and Zn-finger, B-bo... 193 4e-48
gi|17533953|ref|NP_494245.1| RING zinc finger containing protein... 187 2e-46
gi|25395435|pir||B88072 protein ZK1240.2 [imported] - Caenorhabd... 187 4e-46
gi|32564316|ref|NP_494241.2| zn-finger, RING and Zn-finger, B-bo... 187 4e-46
gi|17538073|ref|NP_494238.1| ADP-ribosylation factor domain prot... 179 8e-44
gi|17533955|ref|NP_494244.1| b-box zinc finger containing protei... 171 2e-41
gi|17531261|ref|NP_494232.1| zn-finger, RING and Zn-finger, B-bo... 167 3e-40
gi|17538069|ref|NP_494240.1| predicted CDS, ADP-ribosylation fac... 150 4e-35
gi|17535019|ref|NP_494227.1| RING zinc finger containing protein... 149 1e-34
gi|17538067|ref|NP_494237.1| predicted CDS, putative nuclear pro... 145 1e-33
gi|25153296|ref|NP_741866.1| ring finger family member (XJ448) [... 144 2e-33
gi|7496652|pir||T15689 hypothetical protein C28G1.3 - Caenorhabd... 143 6e-33
gi|25153293|ref|NP_509495.2| RING zinc finger containing protein... 110 4e-23
gi|17533927|ref|NP_494271.1| major sperm protein domain and Zn-... 84 4e-15
gi|39589263|emb|CAE57996.1| Hypothetical protein CBG01059 [Caeno... 77 7e-13
gi|39597154|emb|CAE59381.1| Hypothetical protein CBG02734 [Caeno... 77 7e-13
gi|47228454|emb|CAG05274.1| unnamed protein product [Tetraodon n... 74 6e-12
gi|48101591|ref|XP_392690.1| similar to GTP-binding protein ARD-... 74 6e-12
gi|50761533|ref|XP_424752.1| PREDICTED: similar to GTP-binding p... 70 9e-11
gi|26354048|dbj|BAC40654.1| unnamed protein product [Mus musculus] 69 1e-10
gi|31560638|ref|NP_033303.2| 52kD Ro/SSA autoantigen; Sjogren sy... 69 2e-10
gi|25151349|ref|NP_496089.2| ARF-related in C-term, ARD family, ... 69 2e-10
gi|7510990|pir||T27752 hypothetical protein ZK1320.6 - Caenorhab... 69 2e-10
gi|17505791|ref|NP_491223.1| ADP-ribosylation factor domain prot... 68 2e-10
gi|3024571|sp|Q62191|RO52_MOUSE 52 kDa Ro protein (Sjogren syndr... 68 3e-10
gi|14010849|ref|NP_109631.1| tripartite motif protein TRIM2; neu... 68 3e-10
gi|13446227|ref|NP_056086.1| tripartite motif-containing 2; trip... 68 3e-10
gi|26333433|dbj|BAC30434.1| unnamed protein product [Mus musculus] 68 3e-10
gi|34857890|ref|XP_342269.1| similar to KIAA0517 protein [Rattus... 68 3e-10
gi|50415349|gb|AAH77512.1| Unknown (protein for MGC:82681) [Xeno... 68 3e-10
gi|7513001|pir||T00082 hypothetical protein KIAA0517 - human (fr... 68 3e-10
gi|34921712|sp|Q8BGX0|ARD1_MOUSE GTP-binding protein ARD-1 (ADP-... 67 6e-10
gi|26326825|dbj|BAC27156.1| unnamed protein product [Mus musculus] 67 6e-10
gi|29789263|ref|NP_109656.1| tripartite motif protein 23; tripar... 67 6e-10
gi|50746128|ref|XP_420365.1| PREDICTED: similar to tripartite mo... 66 1e-09
gi|39590419|emb|CAE66158.1| Hypothetical protein CBG11389 [Caeno... 65 2e-09
gi|39591330|emb|CAE73383.1| Hypothetical protein CBG20823 [Caeno... 65 3e-09
gi|4502197|ref|NP_001647.1| ADP-ribosylation factor domain prote... 64 6e-09
gi|422756|pir||A46054 GTP-binding protein ARD 1 - human 64 6e-09
gi|15208643|ref|NP_150231.1| ADP-ribosylation factor domain prot... 64 6e-09
gi|15208641|ref|NP_150230.1| ADP-ribosylation factor domain prot... 64 6e-09
gi|17538007|ref|NP_496180.1| ADP-ribosylation factor domain prot... 63 8e-09
gi|543840|sp|P36407|ARD1_RAT GTP-binding protein ARD-1 (ADP-ribo... 63 8e-09
gi|16877522|gb|AAH17017.1| Tripartite motif protein 31, isoform ... 63 1e-08
gi|34853747|ref|XP_342184.1| ADP-ribosylation factor domain prot... 63 1e-08
gi|30584893|gb|AAP36702.1| Homo sapiens tripartite motif-contain... 63 1e-08
gi|17561342|ref|NP_507996.1| protein factor like family member (... 63 1e-08
gi|21363032|sp|Q9BZY9|TM31_HUMAN Tripartite motif protein 31 >gn... 62 1e-08
gi|16445352|ref|NP_008959.2| tripartite motif protein 31 isoform... 62 2e-08
gi|12275862|gb|AAG50166.1| tripartite motif protein TRIM31 beta ... 62 2e-08
gi|30142677|ref|NP_839971.1| tripartite motif protein 50 [Mus mu... 62 2e-08
gi|39586085|emb|CAE69161.1| Hypothetical protein CBG15192 [Caeno... 62 2e-08
gi|16445354|ref|NP_438111.1| tripartite motif protein 31 isoform... 62 2e-08
gi|17531257|ref|NP_494235.1| predicted CDS, putative protein, wi... 62 2e-08
gi|17534001|ref|NP_496523.1| ADP-ribosylation factor domain prot... 61 3e-08
gi|30842804|ref|NP_851594.1| tripartite motif protein 50 [Rattus... 61 4e-08
gi|25395612|pir||A88284 protein ZK945.5 [imported] - Caenorhabdi... 61 4e-08
gi|17549986|ref|NP_509564.1| membrane-associated nucleic acid bi... 60 5e-08
gi|27660717|ref|XP_219011.1| similar to 52kD Ro/SSA autoantigen ... 60 5e-08
gi|39587801|emb|CAE67819.1| Hypothetical protein CBG13399 [Caeno... 60 5e-08
gi|47227859|emb|CAG09022.1| unnamed protein product [Tetraodon n... 60 5e-08
gi|49522062|gb|AAH75100.1| Unknown (protein for MGC:79572) [Xeno... 60 5e-08
gi|32454737|ref|NP_150594.2| tripartite motif-containing 3; brai... 60 7e-08
gi|33468961|ref|NP_061368.1| tripartite motif protein 3; ring fi... 60 9e-08
gi|13929112|ref|NP_113974.1| ring finger protein 22 [Rattus norv... 60 9e-08
gi|49257592|gb|AAH74184.1| Unknown (protein for MGC:82029) [Xeno... 60 9e-08
gi|21362992|sp|O75382|TRM3_HUMAN Tripartite motif protein 3 (RIN... 60 9e-08
gi|47606181|sp|Q8IYM9|TM22_HUMAN Tripartite motif protein 22 (RI... 60 9e-08
gi|49117096|gb|AAH72842.1| Unknown (protein for MGC:80218) [Xeno... 60 9e-08
gi|39591346|emb|CAE73399.1| Hypothetical protein CBG20840 [Caeno... 59 1e-07
gi|47218690|emb|CAG12414.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|15208660|ref|NP_003132.2| 52kD Ro/SSA autoantigen; Sjogren sy... 59 2e-07
gi|14994115|gb|AAK76432.1| SSA1 [Homo sapiens] 59 2e-07
gi|283833|pir||A43906 nuclear phosphoprotein xnf7 - African claw... 59 2e-07
gi|50301248|gb|AAT73777.1| TRIM5/cyclophilin A fusion protein [A... 59 2e-07
gi|34365285|emb|CAE45973.1| hypothetical protein [Homo sapiens] 58 3e-07
gi|20070649|gb|AAH26930.1| Tripartite motif-containing 38 [Homo ... 58 3e-07
gi|5454014|ref|NP_006346.1| tripartite motif-containing 38; Ro/S... 58 3e-07
gi|12407375|gb|AAG53476.1| tripartite motif protein TRIM3 isofor... 58 3e-07
gi|39591331|emb|CAE73384.1| Hypothetical protein CBG20824 [Caeno... 58 3e-07
gi|1311667|gb|AAB35876.1| nuclear factor 7 [Xenopus laevis] 58 3e-07
gi|50752528|ref|XP_422816.1| PREDICTED: similar to tumor suppres... 57 4e-07
gi|12407373|gb|AAG53475.1| tripartite motif protein TRIM3 isofor... 57 4e-07
gi|50757994|ref|XP_415709.1| PREDICTED: similar to tripartite mo... 57 6e-07
gi|39594727|emb|CAE70595.1| Hypothetical protein CBG17264 [Caeno... 57 8e-07
gi|17569919|ref|NP_508948.1| arginase/agmatinase/formiminoglutam... 57 8e-07
gi|1770499|emb|CAA69165.1| put. ring protein [Homo sapiens] 57 8e-07
gi|480989|pir||S37583 RING finger protein rfp - mouse (fragment)... 57 8e-07
gi|26329457|dbj|BAC28467.1| unnamed protein product [Mus musculus] 56 1e-06
gi|39591347|emb|CAE73400.1| Hypothetical protein CBG20841 [Caeno... 56 1e-06
gi|5174699|ref|NP_006065.1| tripartite motif-containing 22; stim... 56 1e-06
gi|39591329|emb|CAE73382.1| Hypothetical protein CBG20822 [Caeno... 56 1e-06
gi|50418106|gb|AAH77164.1| Unknown (protein for MGC:91888) [Dani... 56 1e-06
gi|30583897|gb|AAP36197.1| Homo sapiens ret finger protein [synt... 56 1e-06
gi|338490|gb|AAA36651.1| 52-kD SS-A/Ro autoantigen 56 1e-06
gi|5851985|emb|CAB55434.1| dJ25J6.4 (ret finger protein) [Homo s... 56 1e-06
gi|7508991|pir||T32840 hypothetical protein W04H10.3 - Caenorhab... 56 1e-06
gi|39585253|emb|CAE57496.1| Hypothetical protein CBG00468 [Caeno... 56 1e-06
gi|47122750|gb|AAH69924.1| Trim27 protein [Mus musculus] 56 1e-06
gi|50403687|sp|Q62158|RFP_MOUSE Zinc-finger protein RFP (Ret fin... 56 1e-06
gi|5730009|ref|NP_006501.1| ret finger protein isoform alpha; tr... 56 1e-06
gi|32564296|ref|NP_493768.3| NHL domain containing (nhl-3) [Caen... 56 1e-06
gi|26353124|dbj|BAC40192.1| unnamed protein product [Mus musculus] 56 1e-06
gi|44890750|gb|AAH66924.1| Ret finger protein, isoform alpha [Ho... 56 1e-06
gi|15011933|ref|NP_112212.1| ret finger protein isoform beta; tr... 56 1e-06
gi|340026|gb|AAA36786.1| tyrosine kinase 56 1e-06
gi|47227079|emb|CAG00441.1| unnamed protein product [Tetraodon n... 55 2e-06
gi|39586963|emb|CAE62898.1| Hypothetical protein CBG07087 [Caeno... 55 2e-06
gi|47216281|emb|CAF96577.1| unnamed protein product [Tetraodon n... 55 2e-06
gi|50344922|ref|NP_001002133.1| zgc:86757 [Danio rerio] >gnl|BL_... 55 3e-06
gi|28480484|ref|XP_133616.2| tripartite motif protein 6 [Mus mus... 55 3e-06
gi|28839627|gb|AAH47956.1| MGC52568 protein [Xenopus laevis] 55 3e-06
gi|17542872|ref|NP_500811.1| predicted CDS, ankyrin-repeat conta... 55 3e-06
gi|47087095|ref|NP_998727.1| tripartite motif protein 39 [Rattus... 54 4e-06
gi|32880219|ref|NP_872596.1| Sjogren syndrome antigen A1 (52kDa,... 54 4e-06
gi|1488047|gb|AAB05873.1| RING finger protein 54 4e-06
gi|39588856|emb|CAE69486.1| Hypothetical protein CBG15689 [Caeno... 54 4e-06
gi|34870771|ref|XP_340807.1| similar to tripartite motif protein... 54 4e-06
gi|46249651|gb|AAH68934.1| LOC397847 protein [Xenopus laevis] 54 5e-06
gi|39586523|emb|CAE73650.1| Hypothetical protein CBG21151 [Caeno... 54 6e-06
gi|22122567|ref|NP_666189.1| cDNA sequence BC026666 [Mus musculu... 54 6e-06
gi|34852126|ref|XP_227945.2| similar to Tripartite motif protein... 54 6e-06
gi|47559193|gb|AAT10388.2| tripartite motif protein TRIM5alpha [... 53 8e-06
gi|50726942|gb|AAT81167.1| TRIM5-alpha [Cercopithecus aethiops] 53 8e-06
gi|6677727|ref|NP_033080.1| tripartite motif protein 27; ret fin... 53 8e-06
gi|19924163|ref|NP_115977.2| muscle specific ring finger protein... 53 8e-06
gi|47523460|ref|NP_999351.1| tripartite motif protein 50 [Sus sc... 53 8e-06
gi|12844768|dbj|BAB26491.1| unnamed protein product [Mus musculus] 53 8e-06
gi|12407389|gb|AAG53483.1| tripartite motif protein TRIM5 isofor... 53 8e-06
gi|34876178|ref|XP_214485.2| similar to ret finger protein [Ratt... 53 8e-06
gi|44890117|gb|AAS48506.1| tripartite motif-containing 5 gamma i... 53 8e-06
gi|15011946|ref|NP_149084.1| tripartite motif protein TRIM5 isof... 53 8e-06
gi|12407383|gb|AAG53480.1| tripartite motif protein TRIM5 isofor... 53 8e-06
gi|38605459|sp|Q9C035|TRM5_HUMAN Tripartite motif protein 5 >gnl... 53 8e-06
gi|44890115|gb|AAS48505.1| tripartite motif-containing 5 alpha i... 53 8e-06
gi|48994823|gb|AAT48102.1| Trim5 alpha [Macaca mulatta] 53 8e-06
gi|15011944|ref|NP_149083.1| tripartite motif protein TRIM5 isof... 53 8e-06
gi|18204217|gb|AAH21258.1| Tripartite motif protein TRIM5, isofo... 53 8e-06
gi|48994825|gb|AAT48103.1| Trim5 alpha [Cercopithecus aethiops] 53 1e-05
gi|48994827|gb|AAT48104.1| Trim5 alpha [Cercopithecus aethiops] 53 1e-05
gi|27477053|ref|NP_444314.1| tripartite motif protein 32 [Mus mu... 53 1e-05
gi|21706608|gb|AAH34104.1| Tripartite motif protein 32 [Mus musc... 53 1e-05
gi|20178303|sp|Q13049|HT2A_HUMAN Zinc-finger protein HT2A (72 kD... 53 1e-05
gi|27714689|ref|XP_233039.1| similar to tripartite motif protein... 53 1e-05
gi|47215426|emb|CAG01123.1| unnamed protein product [Tetraodon n... 53 1e-05
gi|22749455|ref|NP_689950.1| hypothetical protein MGC33993 [Homo... 52 1e-05
gi|34147266|ref|NP_899027.1| hypothetical protein C630023L15 [Mu... 52 1e-05
gi|26343505|dbj|BAC35409.1| unnamed protein product [Mus musculus] 52 1e-05
gi|13277376|ref|NP_077788.1| tripartite motif protein 39; ring f... 52 1e-05
gi|13507607|ref|NP_109609.1| tripartite motif protein 34 [Mus mu... 52 1e-05
gi|39586244|emb|CAE66655.1| Hypothetical protein CBG11992 [Caeno... 52 1e-05
gi|12407451|gb|AAG53514.1| tripartite motif protein TRIM34 gamma... 52 1e-05
gi|12407447|gb|AAG53512.1| tripartite motif protein TRIM34 alpha... 52 1e-05
gi|21594157|gb|AAH31540.1| Trim39 protein [Mus musculus] 52 1e-05
gi|8922648|ref|NP_060677.1| hypothetical protein FLJ10759 [Homo ... 52 2e-05
gi|21748764|dbj|BAC03481.1| unnamed protein product [Homo sapiens] 52 2e-05
gi|18087807|ref|NP_067629.2| tripartite motif protein 34 isoform... 52 2e-05
gi|30017451|ref|NP_835211.1| RIKEN cDNA 6330414G21 [Mus musculus... 52 2e-05
gi|39589874|emb|CAE60872.1| Hypothetical protein CBG04583 [Caeno... 52 2e-05
gi|30583585|gb|AAP36037.1| ring finger protein 28 [Homo sapiens] 52 2e-05
gi|13171051|emb|CAC33173.1| ring finger protein 28 [Homo sapiens] 52 2e-05
gi|39598081|emb|CAE68773.1| Hypothetical protein CBG14715 [Caeno... 52 2e-05
gi|39598079|emb|CAE68771.1| Hypothetical protein CBG14711 [Caeno... 52 2e-05
gi|34871437|ref|XP_220473.2| similar to hypothetical protein [Ra... 52 2e-05
gi|11022690|dbj|BAB17050.1| interferon-responsive finger protein... 52 2e-05
gi|12963843|ref|NP_076324.1| tripartite motif protein 12 [Mus mu... 52 2e-05
gi|31982207|ref|NP_783608.2| RIKEN cDNA 9230105E10 gene [Mus mus... 52 2e-05
gi|30585235|gb|AAP36890.1| Homo sapiens ring finger protein 28 [... 52 2e-05
gi|39582166|emb|CAE71498.1| Hypothetical protein CBG18425 [Caeno... 51 3e-05
gi|25777698|ref|NP_742013.1| tripartite motif-containing 39 isof... 51 3e-05
gi|30584093|gb|AAP36295.1| Homo sapiens tripartite motif-contain... 51 3e-05
gi|30794216|ref|NP_112223.1| tripartite motif-containing 56 [Hom... 51 3e-05
gi|12654759|gb|AAH01222.1| Hypothetical protein FLJ10759 [Homo s... 51 3e-05
gi|47220874|emb|CAG03081.1| unnamed protein product [Tetraodon n... 51 3e-05
gi|46091149|dbj|BAD13703.1| TRIM39 protein [Homo sapiens] 51 3e-05
gi|25777696|ref|NP_067076.2| tripartite motif-containing 39 isof... 51 3e-05
gi|21751638|dbj|BAC04004.1| unnamed protein product [Homo sapiens] 51 3e-05
gi|18641345|ref|NP_569074.1| tripartite motif protein 34 isoform... 51 3e-05
gi|6912426|ref|NP_036342.1| TAT-interactive protein, 72-KD; trip... 51 3e-05
gi|33877724|gb|AAH11882.1| TRIM56 protein [Homo sapiens] 51 3e-05
gi|33869766|gb|AAH05847.2| TRIM56 protein [Homo sapiens] 51 3e-05
gi|18043336|gb|AAH20102.1| Trim11 protein [Mus musculus] 51 4e-05
gi|33878170|gb|AAH21259.1| LOC201292 protein [Homo sapiens] 51 4e-05
gi|16716455|ref|NP_444398.1| tripartite motif protein 11 [Mus mu... 51 4e-05
gi|34873374|ref|XP_232757.2| similar to RIKEN cDNA 6330414G21 [R... 51 4e-05
gi|38679905|ref|NP_775818.2| hypothetical protein LOC201292 [Hom... 51 4e-05
gi|48994833|gb|AAT48107.1| Trim1 beta [Cercopithecus aethiops] 50 5e-05
gi|31746567|gb|AAF60661.2| Hypothetical protein Y47G6A.14 [Caeno... 50 5e-05
gi|15079952|gb|AAH11763.1| TRIM4 protein [Homo sapiens] >gnl|BL_... 50 5e-05
gi|18202956|sp|Q9HCM9|RN23_HUMAN RING finger protein 23 (Testis-... 50 5e-05
gi|27670125|ref|XP_220359.1| similar to glycogenin-interacting p... 50 5e-05
gi|321074|pir||S28418 probable zinc-binding protein - Iberian ri... 50 5e-05
gi|34857519|ref|XP_345222.1| similar to RIKEN cDNA 2310035M22 [R... 50 5e-05
gi|15011941|ref|NP_149082.1| tripartite motif protein TRIM4 isof... 50 5e-05
gi|48994831|gb|AAT48106.1| Trim1 alpha [Cercopithecus aethiops] 50 5e-05
gi|14719418|ref|NP_149023.1| tripartite motif protein TRIM5 isof... 50 5e-05
gi|27679216|ref|XP_219046.1| similar to 9230105E10Rik protein [R... 50 7e-05
gi|39591345|emb|CAE73398.1| Hypothetical protein CBG20839 [Caeno... 50 7e-05
gi|30023818|ref|NP_835226.1| tripartite motif protein 50A; tripa... 50 7e-05
gi|29465650|gb|AAL91072.1| tripartite motif protein 50 isoform b... 50 7e-05
gi|34875177|ref|XP_344418.1| similar to tripartite motif protein... 50 7e-05
gi|50745194|ref|XP_420016.1| PREDICTED: similar to CG10958-like ... 50 9e-05
gi|41235779|ref|NP_958761.1| similar to tripartite motif-contain... 50 9e-05
gi|28278996|gb|AAH45615.1| A130009K11Rik protein [Mus musculus] 50 9e-05
gi|16445412|ref|NP_434698.1| ret finger protein 2; candidate tum... 50 9e-05
gi|8928179|sp|O60858|RPF2_HUMAN Ret finger protein 2 (Leukemia a... 50 9e-05
gi|47506875|gb|AAH70974.1| MGC78802 protein [Xenopus laevis] 49 1e-04
gi|14009638|gb|AAK51689.1| putative tumor suppressor LEU5/RFP2 [... 49 1e-04
gi|47939821|gb|AAH72302.1| LOC432183 protein [Xenopus laevis] 49 1e-04
gi|38082316|ref|XP_110239.2| tripartite motif protein 15 [Mus mu... 49 2e-04
gi|17536885|ref|NP_496525.1| ADP-ribosylation factor domain prot... 49 2e-04
gi|20270353|ref|NP_620155.1| tripartite motif-containing 43 [Hom... 49 2e-04
gi|41055281|ref|NP_957389.1| similar to ring finger protein 30 [... 49 2e-04
gi|20071126|gb|AAH27186.1| Similar to tripartite motif-containin... 49 2e-04
gi|39595761|emb|CAE67264.1| Hypothetical protein CBG12711 [Caeno... 49 2e-04
gi|17509101|ref|NP_491266.1| tripartite motif protein TRIM2 (88.... 49 2e-04
gi|47206520|emb|CAF95730.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|14149754|ref|NP_075722.1| tripartite motif protein 13; ret fi... 49 2e-04
gi|26379548|dbj|BAC25419.1| unnamed protein product [Mus musculus] 49 2e-04
gi|47211208|emb|CAF90165.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|39591348|emb|CAE73401.1| Hypothetical protein CBG20842 [Caeno... 49 2e-04
gi|14581675|gb|AAK56791.1| putative transcription factor ret fin... 49 2e-04
gi|17553362|ref|NP_497169.1| predicted CDS, tripartite motif pro... 48 3e-04
gi|18079262|ref|NP_477514.1| tripartite motif protein 6 [Homo sa... 48 3e-04
gi|17736769|emb|CAD19102.1| dJ820B18.2 (midline 1 (Opitz/BBB syn... 48 3e-04
gi|16445409|ref|NP_438112.1| midline 2 isoform 2; tripartite mot... 48 3e-04
gi|50754723|ref|XP_414478.1| PREDICTED: similar to Zinc finger p... 48 3e-04
gi|30584925|gb|AAP36724.1| Homo sapiens midline 2 [synthetic con... 48 3e-04
gi|28837282|gb|AAH47564.1| TRIM6 protein [Homo sapiens] 48 3e-04
gi|6912504|ref|NP_036348.1| midline 2 isoform 1; tripartite moti... 48 3e-04
gi|6754692|ref|NP_034927.1| midline 1 [Mus musculus] >gnl|BL_ORD... 48 3e-04
gi|48103749|ref|XP_395638.1| similar to putative scaffolding pro... 48 3e-04
gi|31874062|emb|CAD97947.1| hypothetical protein [Homo sapiens] 48 3e-04
gi|584704|sp|Q02084|A33_PLEWA Zinc-binding protein A33 >gnl|BL_O... 48 3e-04
gi|15240646|ref|NP_196857.1| protein kinase family protein / ank... 48 3e-04
gi|27436877|ref|NP_775107.1| tripartite motif-containing 59; mou... 48 3e-04
gi|47218749|emb|CAG02735.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|47227011|emb|CAG05903.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|12621082|ref|NP_075216.1| midline 1; Finger on X and Y (in ra... 48 3e-04
gi|7513805|pir||T09013 RING finger protein Fxy - mouse >gnl|BL_O... 48 3e-04
gi|13529425|gb|AAH05447.1| Trim30 protein [Mus musculus] 48 3e-04
gi|38091370|ref|XP_111186.2| similar to hypothetical protein [Mu... 47 5e-04
gi|26338478|dbj|BAC32910.1| unnamed protein product [Mus musculus] 47 5e-04
gi|27734873|ref|NP_775828.1| ring finger protein 152 [Homo sapie... 47 5e-04
gi|46250250|gb|AAH68444.1| Unknown (protein for MGC:86976) [Homo... 47 5e-04
gi|6754694|ref|NP_035975.1| midline 2 [Mus musculus] >gnl|BL_ORD... 47 6e-04
gi|17985999|ref|NP_536771.1| ring finger protein 36 [Mus musculu... 47 6e-04
gi|27680501|ref|XP_219409.1| similar to hypothetical protein FLJ... 47 6e-04
gi|30520249|ref|NP_848894.1| RIKEN cDNA A930029B02 gene [Mus mus... 47 6e-04
gi|48101992|ref|XP_392730.1| similar to NHL domain containing (n... 47 6e-04
gi|22653813|sp|P82457|MID1_MUSSP Midline 1 protein (Tripartite m... 47 6e-04
gi|15451854|ref|NP_150633.1| midline 1 isoform beta; midline-1; ... 47 8e-04
gi|50414796|gb|AAH77305.1| Unknown (protein for MGC:80210) [Xeno... 47 8e-04
gi|3462503|gb|AAC32998.1| midline 1 cerebellar isoform 1 [Homo s... 47 8e-04
gi|12848905|dbj|BAB28131.1| unnamed protein product [Mus musculus] 47 8e-04
gi|38092305|ref|XP_359262.1| similar to hypothetical protein [Mu... 47 8e-04
gi|29648307|ref|NP_080139.2| mouse RING finger 1; tumor suppress... 47 8e-04
gi|34881561|ref|XP_343826.1| similar to midline 2 protein [Rattu... 47 8e-04
gi|47940004|gb|AAH72370.1| MGC84499 protein [Xenopus laevis] 47 8e-04
gi|3462505|gb|AAC32999.1| midline 1 cerebellar isoform 2 [Homo s... 47 8e-04
gi|4557753|ref|NP_000372.1| midline 1 isoform alpha; midline-1; ... 47 8e-04
gi|44680122|ref|NP_976038.1| tripartite motif-containing 7 isofo... 47 8e-04
gi|7508073|pir||T29211 hypothetical protein T20F5.6 - Caenorhabd... 47 8e-04
gi|48994835|gb|AAT48108.1| Trim1 beta [Aotus trivirgatus] 46 0.001
gi|50734173|ref|XP_418995.1| PREDICTED: similar to RIKEN cDNA A9... 46 0.001
gi|50805923|ref|XP_424369.1| PREDICTED: similar to muscle specif... 46 0.001
gi|29747979|gb|AAH50815.1| Ring finger protein 36 [Mus musculus] 46 0.001
gi|47222745|emb|CAG01712.1| unnamed protein product [Tetraodon n... 46 0.001
gi|34859711|ref|XP_219045.2| similar to tripartite motif protein... 46 0.001
gi|47224831|emb|CAG06401.1| unnamed protein product [Tetraodon n... 46 0.001
gi|29294715|gb|AAH49105.1| Trim35 protein [Mus musculus] 46 0.001
gi|21362275|ref|NP_084255.1| tripartite motif-containing 35 [Mus... 46 0.001
gi|26328447|dbj|BAC27962.1| unnamed protein product [Mus musculus] 46 0.001
gi|41149614|ref|XP_370644.1| similar to tripartite motif-contain... 46 0.001
gi|17509103|ref|NP_491267.1| SecA-type chloroplast protein trans... 46 0.001
gi|32425788|gb|AAH53494.1| Trim35 protein [Mus musculus] 46 0.001
gi|14279435|gb|AAK58598.1| midline-1 [Gallus gallus] 46 0.001
gi|45383848|ref|NP_989460.1| midline 1 (Opitz/BBB syndrome) [Gal... 46 0.001
gi|40255281|ref|NP_954597.1| tripartite motif protein 30-like [M... 46 0.001
gi|47219203|emb|CAG11221.1| unnamed protein product [Tetraodon n... 45 0.002
gi|25151067|ref|NP_740796.1| tripartite motif protein 32 like fa... 45 0.002
gi|17510013|ref|NP_491164.1| RING zinc finger containing protein... 45 0.002
gi|6677815|ref|NP_033125.1| tripartite motif protein 30; regulat... 45 0.002
gi|12407363|gb|AAG53470.1| tripartite motif protein [Mus musculus] 45 0.002
gi|20141865|sp|P15533|TM30_MOUSE Tripartite motif protein 30 (Do... 45 0.002
gi|91257|pir||A30891 regulatory protein rpt-1 - mouse 45 0.002
gi|20270917|gb|AAM18475.1| VHSV-induced protein [Oncorhynchus my... 45 0.002
gi|17563724|ref|NP_506726.1| predicted CDS, SecA-type chloroplas... 45 0.002
gi|47202955|emb|CAF94885.1| unnamed protein product [Tetraodon n... 45 0.002
gi|17553358|ref|NP_497167.1| predicted CDS, zinc-finger protein ... 45 0.002
gi|34865435|ref|XP_236463.2| similar to tripartite motif-contain... 45 0.002
gi|41124489|ref|XP_371536.1| similar to tripartite motif-contain... 45 0.003
gi|28804294|dbj|BAC58029.1| probable RING-B-box-coiled coil prot... 45 0.003
gi|49899992|gb|AAH76998.1| Unknown (protein for MGC:89632) [Xeno... 45 0.003
gi|41054063|ref|NP_956172.1| Unknown (protein for MGC:63737); wu... 45 0.003
gi|34853282|ref|XP_345327.1| similar to RiNg Finger protein (rnf... 45 0.003
gi|17558890|ref|NP_506602.1| predicted CDS, kelch-like 10 family... 45 0.003
gi|34878821|ref|NP_149047.2| ring finger protein 29 isoform 2; m... 44 0.004
gi|24939889|emb|CAD24432.1| RING finger protein 29 [Homo sapiens] 44 0.004
gi|17556116|ref|NP_497677.1| putative protein, with at least 4 t... 44 0.004
gi|41146735|ref|XP_373039.1| similar to ring finger protein 129 ... 44 0.004
gi|21362900|sp|Q9BYV6|RN29_HUMAN RING finger protein 29 (Muscle ... 44 0.004
gi|34878844|ref|NP_908974.1| ring finger protein 29 isoform 3; m... 44 0.004
gi|30585345|gb|AAP36945.1| Homo sapiens ring finger protein 29 [... 44 0.004
gi|39591333|emb|CAE73386.1| Hypothetical protein CBG20826 [Caeno... 44 0.004
gi|13160386|emb|CAC32840.1| ring finger protein 29 [Homo sapiens] 44 0.004
gi|34878836|ref|NP_908973.1| ring finger protein 29 isoform 1; m... 44 0.004
gi|34878852|ref|NP_908975.1| ring finger protein 29 isoform 4; m... 44 0.004
gi|50730893|ref|XP_417067.1| PREDICTED: similar to ret finger pr... 44 0.005
gi|15219056|ref|NP_173584.1| preprotein translocase secA family ... 44 0.005
gi|50757584|ref|XP_425348.1| PREDICTED: similar to hypothetical ... 44 0.005
gi|18266714|ref|NP_543179.1| ring finger protein 28; muscle ring... 44 0.005
gi|14588846|emb|CAC43019.1| RING finger protein 29 [Homo sapiens] 44 0.005
gi|14588848|emb|CAC43020.1| RING finger protein 29 [Homo sapiens] 44 0.005
gi|31565626|gb|AAH53704.1| Mid1 protein [Mus musculus] 44 0.005
gi|38078883|ref|XP_131731.3| similar to ring finger protein 28; ... 44 0.005
gi|17529236|gb|AAL38845.1| putative SecA-type chloroplast protei... 44 0.005
gi|25518647|pir||F86349 hypothetical protein F8K7.7 [imported] -... 44 0.005
gi|39589375|emb|CAE74404.1| Hypothetical protein CBG22136 [Caeno... 44 0.007
gi|39579379|emb|CAE74739.1| Hypothetical protein CBG22559 [Caeno... 44 0.007
gi|38503305|sp|Q7YR33|TM15_PANTR Tripartite motif protein 15 (Zi... 44 0.007
gi|23943803|ref|NP_705724.1| RIKEN cDNA 5830442J12 [Mus musculus... 44 0.007
gi|47208912|emb|CAF93116.1| unnamed protein product [Tetraodon n... 44 0.007
gi|50543428|ref|XP_499880.1| hypothetical protein [Yarrowia lipo... 44 0.007
gi|47215415|emb|CAG01112.1| unnamed protein product [Tetraodon n... 44 0.007
gi|37541445|ref|XP_061890.8| similar to tripartite motif-contain... 44 0.007
gi|39586290|emb|CAE66701.1| Hypothetical protein CBG12046 [Caeno... 44 0.007
gi|47195169|emb|CAF94043.1| unnamed protein product [Tetraodon n... 44 0.007
gi|33469244|gb|AAQ19671.1| malin [Homo sapiens] 43 0.009
gi|40255283|ref|NP_940988.2| malin [Homo sapiens] >gnl|BL_ORD_ID... 43 0.009
gi|40385887|ref|NP_954706.1| malin; NHL repeat containing 1 [Rat... 43 0.009
gi|32698740|ref|NP_065921.1| SH3 multiple domains 2; SH3 domain ... 43 0.009
gi|10432612|dbj|BAB13822.1| unnamed protein product [Homo sapiens] 43 0.009
gi|12857367|dbj|BAB30988.1| unnamed protein product [Mus musculus] 43 0.009
gi|26344746|dbj|BAC36022.1| unnamed protein product [Mus musculus] 43 0.009
gi|50759253|ref|XP_417589.1| PREDICTED: similar to hypothetical ... 43 0.009
gi|46250277|gb|AAH68644.1| LOC397846 protein [Xenopus laevis] 43 0.009
gi|50510375|dbj|BAD32173.1| mKIAA0129 protein [Mus musculus] 43 0.009
gi|34883226|ref|XP_347343.1| similar to CG15105-PA [Rattus norve... 43 0.009
gi|39540508|ref|NP_083353.1| PU.1 binding protein Pub [Mus muscu... 43 0.009
gi|12407425|gb|AAG53501.1| tripartite motif protein TRIM13 beta ... 43 0.009
gi|50732101|ref|XP_418478.1| PREDICTED: similar to RIKEN cDNA 93... 43 0.009
gi|17543448|ref|NP_502615.1| ADP-ribosylation factor domain prot... 43 0.011
gi|17543450|ref|NP_502624.1| ADP-ribosylation factor domain prot... 43 0.011
gi|38077402|ref|XP_355438.1| similar to ring finger protein 29 i... 43 0.011
gi|39588890|emb|CAE69520.1| Hypothetical protein CBG15729 [Caeno... 43 0.011
gi|50417175|gb|AAH78201.1| Unknown (protein for MGC:101050) [Dan... 43 0.011
gi|47228165|emb|CAF97794.1| unnamed protein product [Tetraodon n... 43 0.011
gi|21450806|ref|NP_659488.1| hypothetical protein MGC4734 [Homo ... 43 0.011
gi|47226889|emb|CAG05781.1| unnamed protein product [Tetraodon n... 43 0.011
gi|47225230|emb|CAG09730.1| unnamed protein product [Tetraodon n... 43 0.011
gi|17539210|ref|NP_500203.1| tripartite motif protein 50 like (6... 43 0.011
gi|47222746|emb|CAG01713.1| unnamed protein product [Tetraodon n... 43 0.011
gi|26343091|dbj|BAC35202.1| unnamed protein product [Mus musculus] 43 0.011
gi|31205499|ref|XP_311701.1| ENSANGP00000015141 [Anopheles gambi... 43 0.011
gi|1488045|gb|AAB05872.1| RING finger protein 42 0.015
gi|33416737|gb|AAH56131.1| MGC69169 protein [Xenopus laevis] 42 0.015
gi|42656052|ref|XP_377555.1| similar to RIKEN cDNA 5830442J12 [H... 42 0.015
gi|24047222|gb|AAH38585.1| Tripartite motif protein 15, isoform ... 42 0.015
gi|25009482|sp|Q9C019|TM15_HUMAN Tripartite motif protein 15 (Zi... 42 0.015
gi|34559853|gb|AAQ75551.1| HSD-34 [Homo sapiens] 42 0.015
gi|28839681|gb|AAH47945.1| Ring finger protein 36, isoform a [Ho... 42 0.015
gi|39584642|emb|CAE72395.1| Hypothetical protein CBG19552 [Caeno... 42 0.015
gi|40353773|ref|NP_056246.2| BIA2 protein [Homo sapiens] 42 0.015
gi|34873114|ref|XP_233724.2| similar to RIKEN cDNA 9430015G10 [R... 42 0.015
gi|39588892|emb|CAE69522.1| Hypothetical protein CBG15731 [Caeno... 42 0.015
gi|39591328|emb|CAE73381.1| Hypothetical protein CBG20821 [Caeno... 42 0.019
gi|30425030|ref|NP_780549.1| malin [Mus musculus] >gnl|BL_ORD_ID... 42 0.019
gi|24665272|ref|NP_648886.1| CG16807-PA [Drosophila melanogaster... 42 0.019
gi|39591332|emb|CAE73385.1| Hypothetical protein CBG20825 [Caeno... 42 0.019
gi|38328498|gb|AAH62252.1| Unknown (protein for IMAGE:864596) [M... 42 0.019
gi|15100170|ref|NP_150232.1| tripartite motif protein 15 isoform... 42 0.019
gi|9929937|dbj|BAB12125.1| hypothetical protein [Macaca fascicul... 42 0.019
gi|26345272|dbj|BAC36286.1| unnamed protein product [Mus musculus] 42 0.019
gi|21619928|gb|AAH33211.1| Similar to tripartite motif-containin... 42 0.019
gi|17569707|ref|NP_508057.1| zinc-finger protein ht2a like famil... 42 0.019
gi|47227681|emb|CAG09678.1| unnamed protein product [Tetraodon n... 42 0.019
gi|39588341|emb|CAE72692.1| Hypothetical protein CBG19915 [Caeno... 42 0.019
gi|39584643|emb|CAE72396.1| Hypothetical protein CBG19553 [Caeno... 42 0.019
gi|34852037|ref|XP_227954.2| similar to testis-abundant finger p... 42 0.025
gi|17569179|ref|NP_508689.1| tektin (XE623) [Caenorhabditis eleg... 42 0.025
gi|50731564|ref|XP_418278.1| PREDICTED: similar to ring finger p... 42 0.025
gi|49115834|gb|AAH73577.1| Unknown (protein for MGC:82874) [Xeno... 42 0.025
gi|28484764|ref|XP_283711.1| similar to RIKEN cDNA 9130020G10 [M... 42 0.025
gi|26347621|dbj|BAC37459.1| unnamed protein product [Mus musculus] 42 0.025
gi|50507835|emb|CAB07413.2| Hypothetical protein T08D2.4 [Caenor... 42 0.025
gi|27228994|ref|NP_080062.2| RIKEN cDNA 9130020G10 [Mus musculus... 42 0.025
gi|47077485|dbj|BAD18630.1| unnamed protein product [Homo sapiens] 42 0.025
gi|50759404|ref|XP_425752.1| PREDICTED: similar to hypothetical ... 41 0.033
gi|50803909|ref|XP_424293.1| PREDICTED: similar to ring finger p... 41 0.033
gi|34858863|ref|XP_215027.2| similar to tripartite motif protein... 41 0.033
gi|41471313|gb|AAS07397.1| unknown [Homo sapiens] 41 0.033
gi|41053615|ref|NP_956578.1| hypothetical protein MGC56368 [Dani... 41 0.033
gi|17505504|ref|NP_491737.1| RING zinc finger containing protein... 41 0.033
gi|50756859|ref|XP_415328.1| PREDICTED: similar to Tripartite mo... 41 0.033
gi|38524612|ref|NP_942150.1| tripartite motif-containing 50C [Ho... 41 0.043
gi|37538597|ref|XP_351724.1| similar to tripartite motif protein... 41 0.043
gi|38074380|ref|XP_111412.2| similar to RING finger protein 15 (... 41 0.043
gi|32408171|ref|XP_324567.1| PROTEIN UVS-2 [Neurospora crassa] >... 41 0.043
gi|39591327|emb|CAE73380.1| Hypothetical protein CBG20820 [Caeno... 41 0.043
gi|26324804|dbj|BAC26156.1| unnamed protein product [Mus musculu... 41 0.043
gi|34785654|gb|AAH57094.1| Unknown (protein for MGC:73514) [Mus ... 41 0.043
gi|9506663|ref|NP_061935.1| hypothetical protein FLJ20225 [Homo ... 41 0.043
gi|39578793|emb|CAE56161.1| Hypothetical protein CBG23781 [Caeno... 41 0.043
gi|16716453|ref|NP_444396.1| tripartite motif protein 7 [Mus mus... 40 0.056
gi|39580294|emb|CAE73081.1| Hypothetical protein CBG20457 [Caeno... 40 0.056
gi|38049456|ref|XP_122389.2| similar to tripartite motif protein... 40 0.056
gi|50757735|ref|XP_415625.1| PREDICTED: hypothetical protein XP_... 40 0.056
gi|25777692|ref|NP_055881.1| tripartite motif-containing 35 isof... 40 0.056
gi|31199355|ref|XP_308625.1| ENSANGP00000018884 [Anopheles gambi... 40 0.056
gi|5689533|dbj|BAA83050.1| KIAA1098 protein [Homo sapiens] 40 0.056
gi|34875159|ref|XP_221125.2| similar to 52 kDa Ro protein (Sjogr... 40 0.073
gi|1469181|dbj|BAA09478.1| The KIAA0129 gene product is novel. [... 40 0.073
gi|25152764|ref|NP_510631.2| putative protein family member (23.... 40 0.073
gi|15208669|ref|NP_150090.1| tripartite motif protein TRIM14 iso... 40 0.073
gi|15208663|ref|NP_055603.2| tripartite motif protein TRIM14 iso... 40 0.073
gi|31227042|ref|XP_317815.1| ENSANGP00000004820 [Anopheles gambi... 40 0.095
gi|15221223|ref|NP_177577.1| zinc finger (C3HC4-type RING finger... 40 0.095
gi|21592563|gb|AAM64512.1| putative RING zinc finger protein [Ar... 40 0.095
gi|17505506|ref|NP_491738.1| RiNg Finger protein (rnf-1) [Caenor... 40 0.095
gi|21707222|gb|AAH33871.1| TRIM50C protein [Homo sapiens] 40 0.095
gi|34853284|ref|XP_345328.1| similar to hypothetical protein [Ra... 40 0.095
gi|42733953|gb|AAO52042.2| similar to Plasmodium falciparum (iso... 40 0.095
gi|47227861|emb|CAG09024.1| unnamed protein product [Tetraodon n... 40 0.095
gi|39591326|emb|CAE73379.1| Hypothetical protein CBG20819 [Caeno... 40 0.095
gi|47224983|emb|CAF97398.1| unnamed protein product [Tetraodon n... 40 0.095
gi|31746687|gb|AAB52442.2| Ring finger protein protein 1 [Caenor... 40 0.095
gi|47123203|gb|AAH70851.1| LOC431932 protein [Xenopus laevis] 39 0.12
gi|12855490|dbj|BAB30354.1| unnamed protein product [Mus musculus] 39 0.12
gi|39597819|emb|CAE68511.1| Hypothetical protein CBG14325 [Caeno... 39 0.12
gi|12407427|gb|AAG53502.1| tripartite motif protein TRIM13 [Mus ... 39 0.12
gi|48475186|gb|AAT44255.1| unknown protein [Oryza sativa (japoni... 39 0.12
gi|50757502|ref|XP_429488.1| PREDICTED: hypothetical protein XP_... 39 0.12
gi|34855539|ref|XP_345193.1| similar to RING finger protein 29 [... 39 0.12
gi|17563664|ref|NP_506687.1| membrane-associated nucleic acid bi... 39 0.12
gi|39586289|emb|CAE66700.1| Hypothetical protein CBG12045 [Caeno... 39 0.12
gi|47226880|emb|CAG06722.1| unnamed protein product [Tetraodon n... 39 0.12
gi|38454266|ref|NP_942059.1| putative scaffolding protein POSH [... 39 0.16
gi|49116772|gb|AAH73533.1| Unknown (protein for IMAGE:5440104) [... 39 0.16
gi|23479268|gb|EAA16143.1| Krueppel-like protein [Plasmodium yoe... 39 0.16
gi|50752130|ref|XP_422667.1| PREDICTED: similar to KIAA0794 prot... 39 0.16
gi|50259942|gb|EAL22608.1| hypothetical protein CNBB2400 [Crypto... 39 0.21
gi|41282041|ref|NP_941371.1| SH3 multiple domains 2 isoform 2; p... 39 0.21
gi|10946922|ref|NP_067481.1| SH3 multiple domains 2 isoform 1; p... 39 0.21
gi|50746202|ref|XP_420402.1| PREDICTED: similar to SH3 multiple ... 39 0.21
gi|13991704|gb|AAK51467.1| UbcM4-interacting protein 5 [Mus musc... 39 0.21
gi|31543595|ref|NP_542129.2| ubiquitin conjugating enzyme 7 inte... 39 0.21
gi|19263856|gb|AAH25068.1| C330018L13Rik protein [Mus musculus] 39 0.21
gi|50510955|dbj|BAD32463.1| mKIAA1494 protein [Mus musculus] 39 0.21
gi|26352916|dbj|BAC40088.1| unnamed protein product [Mus musculus] 39 0.21
gi|13775218|ref|NP_112587.1| similar to mouse 1110061N23Rik prot... 38 0.28
gi|6625539|emb|CAB63935.1| putative acid finger protein [Sus scr... 38 0.28
gi|17556196|ref|NP_497528.1| predicted CDS, tripartite motif pro... 38 0.28
gi|50757927|ref|XP_425362.1| PREDICTED: similar to RIKEN cDNA 99... 38 0.28
gi|17553622|ref|NP_499028.1| NHL domain containing (109.1 kD) (n... 38 0.28
gi|280546|pir||S28275 hypothetical protein F54G8.4 - Caenorhabdi... 38 0.28
gi|50757133|ref|XP_415394.1| PREDICTED: similar to membrane-asso... 38 0.28
gi|39585013|emb|CAE62664.1| Hypothetical protein CBG06802 [Caeno... 38 0.28
gi|37622899|ref|NP_060543.5| ring finger protein 137; SSA protei... 38 0.28
gi|16923932|gb|AAL31641.1| Ro/SSA1 related protein FLJ10369 [Hom... 38 0.28
gi|15982946|gb|AAL11501.1| SSA protein SS-56 [Homo sapiens] 38 0.28
gi|48105841|ref|XP_396013.1| similar to ENSANGP00000009769 [Apis... 38 0.28
gi|33622331|ref|NP_891872.1| pe-38 [Cryptophlebia leucotreta gra... 38 0.36
gi|41201046|ref|XP_062300.4| similar to RING finger protein 18 (... 38 0.36
gi|12844086|dbj|BAB26231.1| unnamed protein product [Mus musculu... 38 0.36
gi|33563311|ref|NP_789804.1| RIKEN cDNA 1110061N23 [Mus musculus... 38 0.36
gi|17737481|ref|NP_523776.1| CG4909-PA [Drosophila melanogaster]... 38 0.36
gi|7141241|gb|AAF37265.1| Plenty of SH3s [Drosophila melanogaster] 38 0.36
gi|14602261|ref|NP_148808.1| ORF24 PE-38 [Cydia pomonella granul... 38 0.36
gi|39590883|emb|CAE65257.1| Hypothetical protein CBG10147 [Caeno... 38 0.36
gi|42661764|ref|XP_377554.1| similar to hypothetical protein MGC... 38 0.36
gi|17540438|ref|NP_501814.1| predicted CDS, putative nuclear pro... 38 0.36
gi|37595555|ref|NP_060301.2| ring finger protein 125 [Homo sapiens] 38 0.36
gi|13874603|dbj|BAB46910.1| hypothetical protein [Macaca fascicu... 38 0.36
gi|7020569|dbj|BAA91182.1| unnamed protein product [Homo sapiens] 38 0.36
gi|15080562|gb|AAH12021.1| Ring finger protein 125 [Homo sapiens] 38 0.36
gi|27732167|ref|XP_230524.1| similar to Ring finger protein 36 [... 38 0.36
gi|26330171|dbj|BAC25078.1| unnamed protein product [Mus musculus] 38 0.36
gi|46444720|gb|EAL03993.1| hypothetical protein CaO19.4658 [Cand... 37 0.47
gi|24582321|ref|NP_609072.1| CG11321-PA [Drosophila melanogaster... 37 0.47
gi|50757528|ref|XP_415552.1| PREDICTED: similar to hypothetical ... 37 0.47
gi|18138335|ref|NP_542631.1| ORF8 [Helicoverpa zea single nucleo... 37 0.47
gi|12597493|ref|NP_075077.1| ie-0 [Heliocoverpa armigera nucleop... 37 0.47
gi|2078312|gb|AAB54095.1| AcMNPV ORF1 homolog [Helicoverpa zea s... 37 0.47
gi|9837125|gb|AAG00432.1| membrane-associated nucleic acid bindi... 37 0.47
gi|31242773|ref|XP_321817.1| ENSANGP00000009769 [Anopheles gambi... 37 0.47
gi|50540516|ref|NP_001002723.1| zgc:92594 [Danio rerio] >gnl|BL_... 37 0.47
gi|27881691|gb|AAH44642.1| Unknown (protein for MGC:52176) [Homo... 37 0.47
gi|21594048|gb|AAM65966.1| unknown [Arabidopsis thaliana] 37 0.47
gi|18409246|ref|NP_564959.1| zinc finger (C3HC4-type RING finger... 37 0.47
gi|34853881|ref|XP_231249.2| similar to CG16807-PA [Rattus norve... 37 0.47
gi|24582323|ref|NP_723214.1| CG11321-PB [Drosophila melanogaster... 37 0.47
gi|38074631|ref|XP_130233.3| membrane-associated nucleic acid bi... 37 0.47
gi|3377722|gb|AAC64547.1| male-specific lethal-2 [Drosophila vir... 37 0.47
gi|23271192|gb|AAH36012.1| TRIM37 protein [Homo sapiens] 37 0.47
>gi|32564318|ref|NP_494239.2| zn-finger, RING and Zn-finger, B-box
family member (34.9 kD) (2C611) [Caenorhabditis elegans]
gi|28275061|gb|AAL11109.2| Hypothetical protein ZK1240.3
[Caenorhabditis elegans]
Length = 304
Score = 595 bits (1533), Expect = e-169
Identities = 291/304 (95%), Positives = 292/304 (95%)
Frame = +1
Query: 1 MTLPECEICCKEYSNIDQNHSPKILKCGHSICQICAAKLITNSCIYCPFCRETTKIRDGK 180
MTLPECEICCKEYSNIDQNHSPKILKCGHSICQICAAKLITNSCIYCPFCRETTKIRDGK
Sbjct: 1 MTLPECEICCKEYSNIDQNHSPKILKCGHSICQICAAKLITNSCIYCPFCRETTKIRDGK 60
Query: 181 VENLKKNFGLMKAIEIMKNSTTKQDTPGFSPTKCSAHPYNLAEFVCMGNTCSAKDKFMCR 360
VENLKKNFGLMKAIEIMKNSTTKQDTPGFSPTKCSAHPYNLAEFVCM +TCSAKDKFMCR
Sbjct: 61 VENLKKNFGLMKAIEIMKNSTTKQDTPGFSPTKCSAHPYNLAEFVCMVDTCSAKDKFMCR 120
Query: 361 TCEEFGIHKGHARGLLISESAKLREILECRFEKMELNNRIFEEQLKEIRKAGITNITLFN 540
TCEEFGIHKGHARGLLISESAKLREILECRFEKMELNNRIFEEQLKEIRKAGITNITLFN
Sbjct: 121 TCEEFGIHKGHARGLLISESAKLREILECRFEKMELNNRIFEEQLKEIRKAGITNITLFN 180
Query: 541 QKVGKVNLHFKKLHRLLSDQEEAIIEKLELSSSKTYXXXXXXXXXXXQSQEELAKKMERM 720
QKVGKVNLHFKKLHRLLSDQEEAIIEKLELSSSKTY QSQEELAKKMERM
Sbjct: 181 QKVGKVNLHFKKLHRLLSDQEEAIIEKLELSSSKTYELNLEKENKLLQSQEELAKKMERM 240
Query: 721 KTRINLNDTQLFIAGVEMRGPTWYYENELPDCPPATDDVEVRLPTIKIKDCLLELTNEDS 900
KTRINLNDTQLFIAGVEMRGPTWYYENELPDCPPATDDVEVRLPTIKIKDCLLELTNEDS
Sbjct: 241 KTRINLNDTQLFIAGVEMRGPTWYYENELPDCPPATDDVEVRLPTIKIKDCLLELTNEDS 300
Query: 901 SGVT 912
SGVT
Sbjct: 301 SGVT 304