Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= ZK1240_8
         (1032 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|25395437|pir||D88072 protein ZK1240.1 [imported] - Caenorhabd...   593   e-168
gi|32564312|ref|NP_494243.2| zn-finger, RING and Zn-finger, B-bo...   546   e-154
gi|32564316|ref|NP_494241.2| zn-finger, RING and Zn-finger, B-bo...   315   8e-85
gi|25395435|pir||B88072 protein ZK1240.2 [imported] - Caenorhabd...   315   8e-85
gi|17533955|ref|NP_494244.1| b-box zinc finger containing protei...   298   1e-79
gi|17531261|ref|NP_494232.1| zn-finger, RING and Zn-finger, B-bo...   187   3e-46
gi|17533953|ref|NP_494245.1| RING zinc finger containing protein...   177   3e-43
gi|32564318|ref|NP_494239.2| zn-finger, RING and Zn-finger, B-bo...   174   3e-42
gi|25395432|pir||H88071 protein ZK1240.3 [imported] - Caenorhabd...   169   7e-41
gi|17538073|ref|NP_494238.1| ADP-ribosylation factor domain prot...   169   1e-40
gi|17538071|ref|NP_494242.1| zn-finger, RING and Zn-finger, B-bo...   164   3e-39
gi|17531269|ref|NP_494234.1| predicted CDS, RING zinc finger con...   152   2e-35
gi|17538069|ref|NP_494240.1| predicted CDS, ADP-ribosylation fac...   140   5e-32
gi|17535019|ref|NP_494227.1| RING zinc finger containing protein...   132   1e-29
gi|25153296|ref|NP_741866.1| ring finger family member (XJ448) [...   125   1e-27
gi|7496652|pir||T15689 hypothetical protein C28G1.3 - Caenorhabd...   125   1e-27
gi|17538067|ref|NP_494237.1| predicted CDS, putative nuclear pro...   109   1e-22
gi|17533927|ref|NP_494271.1| major sperm protein  domain and Zn-...   108   2e-22
gi|25153293|ref|NP_509495.2| RING zinc finger containing protein...   104   3e-21
gi|39597154|emb|CAE59381.1| Hypothetical protein CBG02734 [Caeno...   100   7e-20
gi|50415349|gb|AAH77512.1| Unknown (protein for MGC:82681) [Xeno...    98   4e-19
gi|47228454|emb|CAG05274.1| unnamed protein product [Tetraodon n...    94   5e-18
gi|34921712|sp|Q8BGX0|ARD1_MOUSE GTP-binding protein ARD-1 (ADP-...    93   9e-18
gi|26326825|dbj|BAC27156.1| unnamed protein product [Mus musculus]     93   9e-18
gi|50761533|ref|XP_424752.1| PREDICTED: similar to GTP-binding p...    93   1e-17
gi|34853747|ref|XP_342184.1| ADP-ribosylation factor domain prot...    92   1e-17
gi|15208641|ref|NP_150230.1| ADP-ribosylation factor domain prot...    92   3e-17
gi|15208643|ref|NP_150231.1| ADP-ribosylation factor domain prot...    92   3e-17
gi|29789263|ref|NP_109656.1| tripartite motif protein 23; tripar...    92   3e-17
gi|4502197|ref|NP_001647.1| ADP-ribosylation factor domain prote...    92   3e-17
gi|422756|pir||A46054 GTP-binding protein ARD 1 - human                92   3e-17
gi|543840|sp|P36407|ARD1_RAT GTP-binding protein ARD-1 (ADP-ribo...    91   4e-17
gi|48101591|ref|XP_392690.1| similar to GTP-binding protein ARD-...    87   8e-16
gi|26354048|dbj|BAC40654.1| unnamed protein product [Mus musculus]     86   2e-15
gi|25151349|ref|NP_496089.2| ARF-related in C-term, ARD family, ...    80   8e-14
gi|39589263|emb|CAE57996.1| Hypothetical protein CBG01059 [Caeno...    76   1e-12
gi|39586523|emb|CAE73650.1| Hypothetical protein CBG21151 [Caeno...    70   1e-10
gi|47218690|emb|CAG12414.1| unnamed protein product [Tetraodon n...    69   1e-10
gi|17534001|ref|NP_496523.1| ADP-ribosylation factor domain prot...    67   5e-10
gi|29648307|ref|NP_080139.2| mouse RING finger 1; tumor suppress...    64   4e-09
gi|50752528|ref|XP_422816.1| PREDICTED: similar to tumor suppres...    64   4e-09
gi|39590419|emb|CAE66158.1| Hypothetical protein CBG11389 [Caeno...    64   6e-09
gi|27436877|ref|NP_775107.1| tripartite motif-containing 59; mou...    64   6e-09
gi|17561342|ref|NP_507996.1| protein factor like family member (...    64   6e-09
gi|31874062|emb|CAD97947.1| hypothetical protein [Homo sapiens]        64   6e-09
gi|13446227|ref|NP_056086.1| tripartite motif-containing 2; trip...    64   7e-09
gi|34857519|ref|XP_345222.1| similar to RIKEN cDNA 2310035M22 [R...    64   7e-09
gi|50746128|ref|XP_420365.1| PREDICTED: similar to tripartite mo...    64   7e-09
gi|7513001|pir||T00082 hypothetical protein KIAA0517 - human (fr...    64   7e-09
gi|6912426|ref|NP_036342.1| TAT-interactive protein, 72-KD; trip...    63   1e-08
gi|46250250|gb|AAH68444.1| Unknown (protein for MGC:86976) [Homo...    63   1e-08
gi|50301248|gb|AAT73777.1| TRIM5/cyclophilin A fusion protein [A...    63   1e-08
gi|39582166|emb|CAE71498.1| Hypothetical protein CBG18425 [Caeno...    63   1e-08
gi|7510990|pir||T27752 hypothetical protein ZK1320.6 - Caenorhab...    62   2e-08
gi|12848905|dbj|BAB28131.1| unnamed protein product [Mus musculus]     62   2e-08
gi|39586085|emb|CAE69161.1| Hypothetical protein CBG15192 [Caeno...    62   2e-08
gi|47559193|gb|AAT10388.2| tripartite motif protein TRIM5alpha [...    62   2e-08
gi|48994825|gb|AAT48103.1| Trim5 alpha [Cercopithecus aethiops]        62   2e-08
gi|50726942|gb|AAT81167.1| TRIM5-alpha [Cercopithecus aethiops]        62   2e-08
gi|48994827|gb|AAT48104.1| Trim5 alpha [Cercopithecus aethiops]        62   2e-08
gi|44890117|gb|AAS48506.1| tripartite motif-containing 5 gamma i...    62   2e-08
gi|44890115|gb|AAS48505.1| tripartite motif-containing 5 alpha i...    62   2e-08
gi|48994823|gb|AAT48102.1| Trim5 alpha [Macaca mulatta]                62   2e-08
gi|27477053|ref|NP_444314.1| tripartite motif protein 32 [Mus mu...    62   3e-08
gi|21706608|gb|AAH34104.1| Tripartite motif protein 32 [Mus musc...    62   3e-08
gi|27714689|ref|XP_233039.1| similar to tripartite motif protein...    62   3e-08
gi|20178303|sp|Q13049|HT2A_HUMAN Zinc-finger protein HT2A (72 kD...    62   3e-08
gi|14010849|ref|NP_109631.1| tripartite motif protein TRIM2; neu...    61   4e-08
gi|17509101|ref|NP_491266.1| tripartite motif protein TRIM2 (88....    61   4e-08
gi|26333433|dbj|BAC30434.1| unnamed protein product [Mus musculus]     61   4e-08
gi|34857890|ref|XP_342269.1| similar to KIAA0517 protein [Rattus...    61   5e-08
gi|17538007|ref|NP_496180.1| ADP-ribosylation factor domain prot...    60   6e-08
gi|25395612|pir||A88284 protein ZK945.5 [imported] - Caenorhabdi...    60   6e-08
gi|49257592|gb|AAH74184.1| Unknown (protein for MGC:82029) [Xeno...    60   8e-08
gi|49117096|gb|AAH72842.1| Unknown (protein for MGC:80218) [Xeno...    60   8e-08
gi|49522062|gb|AAH75100.1| Unknown (protein for MGC:79572) [Xeno...    60   1e-07
gi|12855490|dbj|BAB30354.1| unnamed protein product [Mus musculus]     59   1e-07
gi|7508073|pir||T29211 hypothetical protein T20F5.6 - Caenorhabd...    59   1e-07
gi|39591330|emb|CAE73383.1| Hypothetical protein CBG20823 [Caeno...    59   1e-07
gi|17505791|ref|NP_491223.1| ADP-ribosylation factor domain prot...    59   1e-07
gi|34875177|ref|XP_344418.1| similar to tripartite motif protein...    59   2e-07
gi|39598079|emb|CAE68771.1| Hypothetical protein CBG14711 [Caeno...    59   2e-07
gi|17542872|ref|NP_500811.1| predicted CDS, ankyrin-repeat conta...    59   2e-07
gi|47226889|emb|CAG05781.1| unnamed protein product [Tetraodon n...    59   2e-07
gi|17536885|ref|NP_496525.1| ADP-ribosylation factor domain prot...    59   2e-07
gi|47606181|sp|Q8IYM9|TM22_HUMAN Tripartite motif protein 22 (RI...    59   2e-07
gi|39591346|emb|CAE73399.1| Hypothetical protein CBG20840 [Caeno...    59   2e-07
gi|12407427|gb|AAG53502.1| tripartite motif protein TRIM13 [Mus ...    58   3e-07
gi|14149754|ref|NP_075722.1| tripartite motif protein 13; ret fi...    58   3e-07
gi|14581675|gb|AAK56791.1| putative transcription factor ret fin...    58   3e-07
gi|26379548|dbj|BAC25419.1| unnamed protein product [Mus musculus]     58   3e-07
gi|39587801|emb|CAE67819.1| Hypothetical protein CBG13399 [Caeno...    58   3e-07
gi|39585253|emb|CAE57496.1| Hypothetical protein CBG00468 [Caeno...    58   3e-07
gi|14009638|gb|AAK51689.1| putative tumor suppressor LEU5/RFP2 [...    58   3e-07
gi|5174699|ref|NP_006065.1| tripartite motif-containing 22; stim...    58   4e-07
gi|39591348|emb|CAE73401.1| Hypothetical protein CBG20842 [Caeno...    58   4e-07
gi|17549986|ref|NP_509564.1| membrane-associated nucleic acid bi...    58   4e-07
gi|16445412|ref|NP_434698.1| ret finger protein 2; candidate tum...    57   5e-07
gi|8928179|sp|O60858|RPF2_HUMAN Ret finger protein 2 (Leukemia a...    57   5e-07
gi|12407425|gb|AAG53501.1| tripartite motif protein TRIM13 beta ...    57   5e-07
gi|50730893|ref|XP_417067.1| PREDICTED: similar to ret finger pr...    57   7e-07
gi|17569919|ref|NP_508948.1| arginase/agmatinase/formiminoglutam...    57   9e-07
gi|15240646|ref|NP_196857.1| protein kinase family protein / ank...    57   9e-07
gi|14994115|gb|AAK76432.1| SSA1 [Homo sapiens]                         57   9e-07
gi|12407389|gb|AAG53483.1| tripartite motif protein TRIM5 isofor...    56   1e-06
gi|12407383|gb|AAG53480.1| tripartite motif protein TRIM5 isofor...    56   1e-06
gi|26329457|dbj|BAC28467.1| unnamed protein product [Mus musculus]     56   1e-06
gi|15011944|ref|NP_149083.1| tripartite motif protein TRIM5 isof...    56   1e-06
gi|18204217|gb|AAH21258.1| Tripartite motif protein TRIM5, isofo...    56   1e-06
gi|15011946|ref|NP_149084.1| tripartite motif protein TRIM5 isof...    56   1e-06
gi|38605459|sp|Q9C035|TRM5_HUMAN Tripartite motif protein 5 >gnl...    56   1e-06
gi|47523460|ref|NP_999351.1| tripartite motif protein 50 [Sus sc...    56   2e-06
gi|38328498|gb|AAH62252.1| Unknown (protein for IMAGE:864596) [M...    55   2e-06
gi|39598081|emb|CAE68773.1| Hypothetical protein CBG14715 [Caeno...    55   2e-06
gi|39591347|emb|CAE73400.1| Hypothetical protein CBG20841 [Caeno...    55   2e-06
gi|30842804|ref|NP_851594.1| tripartite motif protein 50 [Rattus...    55   3e-06
gi|15208660|ref|NP_003132.2| 52kD Ro/SSA autoantigen; Sjogren sy...    55   3e-06
gi|39591345|emb|CAE73398.1| Hypothetical protein CBG20839 [Caeno...    55   3e-06
gi|39591333|emb|CAE73386.1| Hypothetical protein CBG20826 [Caeno...    54   4e-06
gi|30142677|ref|NP_839971.1| tripartite motif protein 50 [Mus mu...    54   4e-06
gi|46237686|emb|CAE84058.1| tripartite motif-containing 10 [Ratt...    54   6e-06
gi|34852124|ref|XP_227944.2| similar to Tripartite motif protein...    54   6e-06
gi|38049456|ref|XP_122389.2| similar to tripartite motif protein...    54   6e-06
gi|12963843|ref|NP_076324.1| tripartite motif protein 12 [Mus mu...    54   8e-06
gi|6755340|ref|NP_035410.1| tripartite motif protein 10; ring fi...    54   8e-06
gi|18203572|sp|Q9WUH5|TRMA_MOUSE Tripartite motif protein 10 (RI...    54   8e-06
gi|30186177|gb|AAH51632.1| Tripartite motif protein 10 [Mus musc...    54   8e-06
gi|12844768|dbj|BAB26491.1| unnamed protein product [Mus musculus]     54   8e-06
gi|39588856|emb|CAE69486.1| Hypothetical protein CBG15689 [Caeno...    54   8e-06
gi|31982207|ref|NP_783608.2| RIKEN cDNA 9230105E10 gene [Mus mus...    54   8e-06
gi|50757994|ref|XP_415709.1| PREDICTED: similar to tripartite mo...    53   1e-05
gi|47216281|emb|CAF96577.1| unnamed protein product [Tetraodon n...    53   1e-05
gi|12407373|gb|AAG53475.1| tripartite motif protein TRIM3 isofor...    53   1e-05
gi|12407375|gb|AAG53476.1| tripartite motif protein TRIM3 isofor...    53   1e-05
gi|32454737|ref|NP_150594.2| tripartite motif-containing 3; brai...    53   1e-05
gi|21362992|sp|O75382|TRM3_HUMAN Tripartite motif protein 3 (RIN...    53   1e-05
gi|18087807|ref|NP_067629.2| tripartite motif protein 34 isoform...    53   1e-05
gi|11022690|dbj|BAB17050.1| interferon-responsive finger protein...    53   1e-05
gi|39595761|emb|CAE67264.1| Hypothetical protein CBG12711 [Caeno...    53   1e-05
gi|18641345|ref|NP_569074.1| tripartite motif protein 34 isoform...    53   1e-05
gi|14719418|ref|NP_149023.1| tripartite motif protein TRIM5 isof...    53   1e-05
gi|27679216|ref|XP_219046.1| similar to 9230105E10Rik protein [R...    52   2e-05
gi|13507607|ref|NP_109609.1| tripartite motif protein 34 [Mus mu...    52   2e-05
gi|48101992|ref|XP_392730.1| similar to NHL domain containing (n...    52   2e-05
gi|50745194|ref|XP_420016.1| PREDICTED: similar to CG10958-like ...    52   2e-05
gi|12407451|gb|AAG53514.1| tripartite motif protein TRIM34 gamma...    52   2e-05
gi|12407447|gb|AAG53512.1| tripartite motif protein TRIM34 alpha...    52   2e-05
gi|338490|gb|AAA36651.1| 52-kD SS-A/Ro autoantigen                     52   2e-05
gi|39579379|emb|CAE74739.1| Hypothetical protein CBG22559 [Caeno...    52   2e-05
gi|40255281|ref|NP_954597.1| tripartite motif protein 30-like [M...    52   2e-05
gi|9929937|dbj|BAB12125.1| hypothetical protein [Macaca fascicul...    52   2e-05
gi|33468961|ref|NP_061368.1| tripartite motif protein 3; ring fi...    52   3e-05
gi|41146735|ref|XP_373039.1| similar to ring finger protein 129 ...    52   3e-05
gi|17543448|ref|NP_502615.1| ADP-ribosylation factor domain prot...    52   3e-05
gi|17543450|ref|NP_502624.1| ADP-ribosylation factor domain prot...    52   3e-05
gi|29465650|gb|AAL91072.1| tripartite motif protein 50 isoform b...    51   4e-05
gi|13929112|ref|NP_113974.1| ring finger protein 22 [Rattus norv...    51   4e-05
gi|30023818|ref|NP_835226.1| tripartite motif protein 50A; tripa...    51   4e-05
gi|47224983|emb|CAF97398.1| unnamed protein product [Tetraodon n...    51   4e-05
gi|34876178|ref|XP_214485.2| similar to ret finger protein [Ratt...    51   5e-05
gi|321074|pir||S28418 probable zinc-binding protein - Iberian ri...    51   5e-05
gi|34878852|ref|NP_908975.1| ring finger protein 29 isoform 4; m...    51   5e-05
gi|34878821|ref|NP_149047.2| ring finger protein 29 isoform 2; m...    51   5e-05
gi|24939889|emb|CAD24432.1| RING finger protein 29 [Homo sapiens]      51   5e-05
gi|34878844|ref|NP_908974.1| ring finger protein 29 isoform 3; m...    51   5e-05
gi|34878836|ref|NP_908973.1| ring finger protein 29 isoform 1; m...    51   5e-05
gi|39591331|emb|CAE73384.1| Hypothetical protein CBG20824 [Caeno...    51   5e-05
gi|14588848|emb|CAC43020.1| RING finger protein 29 [Homo sapiens]      50   6e-05
gi|14588846|emb|CAC43019.1| RING finger protein 29 [Homo sapiens]      50   6e-05
gi|31560638|ref|NP_033303.2| 52kD Ro/SSA autoantigen; Sjogren sy...    50   6e-05
gi|3024571|sp|Q62191|RO52_MOUSE 52 kDa Ro protein (Sjogren syndr...    50   6e-05
gi|38077402|ref|XP_355438.1| similar to ring finger protein 29 i...    50   8e-05
gi|26343091|dbj|BAC35202.1| unnamed protein product [Mus musculus]     50   8e-05
gi|17539210|ref|NP_500203.1| tripartite motif protein 50 like (6...    50   8e-05
gi|24665272|ref|NP_648886.1| CG16807-PA [Drosophila melanogaster...    50   8e-05
gi|30584893|gb|AAP36702.1| Homo sapiens tripartite motif-contain...    50   1e-04
gi|47087095|ref|NP_998727.1| tripartite motif protein 39 [Rattus...    50   1e-04
gi|34852037|ref|XP_227954.2| similar to testis-abundant finger p...    50   1e-04
gi|4508005|ref|NP_003440.1| tripartite motif-containing 26; acid...    50   1e-04
gi|38503306|sp|Q7YR34|TM26_PANTR Tripartite motif-containing pro...    50   1e-04
gi|16877522|gb|AAH17017.1| Tripartite motif protein 31, isoform ...    50   1e-04
gi|47227079|emb|CAG00441.1| unnamed protein product [Tetraodon n...    50   1e-04
gi|34785117|gb|AAH56854.1| MGC64451 protein [Xenopus laevis]           50   1e-04
gi|27732167|ref|XP_230524.1| similar to Ring finger protein 36 [...    50   1e-04
gi|27660717|ref|XP_219011.1| similar to 52kD Ro/SSA autoantigen ...    49   1e-04
gi|340026|gb|AAA36786.1| tyrosine kinase                               49   1e-04
gi|5730009|ref|NP_006501.1| ret finger protein isoform alpha; tr...    49   1e-04
gi|44890750|gb|AAH66924.1| Ret finger protein, isoform alpha [Ho...    49   1e-04
gi|21363032|sp|Q9BZY9|TM31_HUMAN Tripartite motif protein 31 >gn...    49   1e-04
gi|50543428|ref|XP_499880.1| hypothetical protein [Yarrowia lipo...    49   1e-04
gi|39591329|emb|CAE73382.1| Hypothetical protein CBG20822 [Caeno...    49   1e-04
gi|5851985|emb|CAB55434.1| dJ25J6.4 (ret finger protein) [Homo s...    49   1e-04
gi|12275862|gb|AAG50166.1| tripartite motif protein TRIM31 beta ...    49   1e-04
gi|1770499|emb|CAA69165.1| put. ring protein [Homo sapiens]            49   1e-04
gi|15011933|ref|NP_112212.1| ret finger protein isoform beta; tr...    49   1e-04
gi|30583897|gb|AAP36197.1| Homo sapiens ret finger protein [synt...    49   1e-04
gi|26343505|dbj|BAC35409.1| unnamed protein product [Mus musculus]     49   2e-04
gi|47506875|gb|AAH70974.1| MGC78802 protein [Xenopus laevis]           49   2e-04
gi|13277376|ref|NP_077788.1| tripartite motif protein 39; ring f...    49   2e-04
gi|21594157|gb|AAH31540.1| Trim39 protein [Mus musculus]               49   2e-04
gi|12407415|gb|AAG53496.1| tripartite motif protein TRIM10 beta ...    49   2e-04
gi|480989|pir||S37583 RING finger protein rfp - mouse (fragment)...    49   2e-04
gi|16445352|ref|NP_008959.2| tripartite motif protein 31 isoform...    49   2e-04
gi|39594727|emb|CAE70595.1| Hypothetical protein CBG17264 [Caeno...    49   2e-04
gi|584704|sp|Q02084|A33_PLEWA Zinc-binding protein A33 >gnl|BL_O...    49   2e-04
gi|16445354|ref|NP_438111.1| tripartite motif protein 31 isoform...    49   2e-04
gi|50414796|gb|AAH77305.1| Unknown (protein for MGC:80210) [Xeno...    49   2e-04
gi|12407413|gb|AAG53495.1| tripartite motif protein TRIM10 alpha...    49   2e-04
gi|47117344|sp|O19085|TRMA_PIG Tripartite motif protein 10 (RING...    49   2e-04
gi|38074380|ref|XP_111412.2| similar to RING finger protein 15 (...    49   2e-04
gi|34855539|ref|XP_345193.1| similar to RING finger protein 29 [...    49   2e-04
gi|17509103|ref|NP_491267.1| SecA-type chloroplast protein trans...    49   2e-04
gi|47227859|emb|CAG09022.1| unnamed protein product [Tetraodon n...    49   2e-04
gi|17556196|ref|NP_497528.1| predicted CDS, tripartite motif pro...    49   2e-04
gi|22760588|dbj|BAC11254.1| unnamed protein product [Homo sapiens]     48   3e-04
gi|34852035|ref|XP_227946.2| similar to Trim26 protein [Rattus n...    48   3e-04
gi|39586289|emb|CAE66700.1| Hypothetical protein CBG12045 [Caeno...    48   3e-04
gi|50759404|ref|XP_425752.1| PREDICTED: similar to hypothetical ...    48   3e-04
gi|50403687|sp|Q62158|RFP_MOUSE Zinc-finger protein RFP (Ret fin...    48   3e-04
gi|30585345|gb|AAP36945.1| Homo sapiens ring finger protein 29 [...    48   3e-04
gi|26353124|dbj|BAC40192.1| unnamed protein product [Mus musculus]     48   3e-04
gi|13160386|emb|CAC32840.1| ring finger protein 29 [Homo sapiens]      48   3e-04
gi|20070649|gb|AAH26930.1| Tripartite motif-containing 38 [Homo ...    48   3e-04
gi|21630277|ref|NP_660215.1| tripartite motif-containing 11 [Hom...    48   3e-04
gi|34859711|ref|XP_219045.2| similar to tripartite motif protein...    48   3e-04
gi|21362900|sp|Q9BYV6|RN29_HUMAN RING finger protein 29 (Muscle ...    48   3e-04
gi|47122750|gb|AAH69924.1| Trim27 protein [Mus musculus]               48   3e-04
gi|50401219|sp|P62603|TM26_RAT Tripartite motif-containing prote...    48   3e-04
gi|38503304|sp|Q7YR32|TRMA_PANTR Tripartite motif protein 10 (RI...    48   4e-04
gi|50403805|sp|Q9UDY6|TRMA_HUMAN Tripartite motif protein 10 (RI...    48   4e-04
gi|26335007|dbj|BAC31204.1| unnamed protein product [Mus musculus]     48   4e-04
gi|28480484|ref|XP_133616.2| tripartite motif protein 6 [Mus mus...    48   4e-04
gi|39586963|emb|CAE62898.1| Hypothetical protein CBG07087 [Caeno...    48   4e-04
gi|17556116|ref|NP_497677.1| putative protein, with at least 4 t...    48   4e-04
gi|34858863|ref|XP_215027.2| similar to tripartite motif protein...    48   4e-04
gi|50731564|ref|XP_418278.1| PREDICTED: similar to ring finger p...    48   4e-04
gi|38083120|ref|XP_359288.1| similar to Trim26 protein [Mus musc...    48   4e-04
gi|5803147|ref|NP_006769.1| tripartite motif-containing 10 isofo...    47   5e-04
gi|16519561|ref|NP_439893.1| tripartite motif-containing 10 isof...    47   5e-04
gi|15011941|ref|NP_149082.1| tripartite motif protein TRIM4 isof...    47   5e-04
gi|5454014|ref|NP_006346.1| tripartite motif-containing 38; Ro/S...    47   5e-04
gi|15079952|gb|AAH11763.1| TRIM4 protein [Homo sapiens] >gnl|BL_...    47   5e-04
gi|34870771|ref|XP_340807.1| similar to tripartite motif protein...    47   5e-04
gi|46091149|dbj|BAD13703.1| TRIM39 protein [Homo sapiens]              47   7e-04
gi|30584093|gb|AAP36295.1| Homo sapiens tripartite motif-contain...    47   7e-04
gi|25777696|ref|NP_067076.2| tripartite motif-containing 39 isof...    47   7e-04
gi|17985999|ref|NP_536771.1| ring finger protein 36 [Mus musculu...    47   7e-04
gi|41471313|gb|AAS07397.1| unknown [Homo sapiens]                      47   7e-04
gi|14670266|ref|NP_148977.1| tripartite motif protein TRIM4 isof...    47   7e-04
gi|25777698|ref|NP_742013.1| tripartite motif-containing 39 isof...    47   7e-04
gi|50418106|gb|AAH77164.1| Unknown (protein for MGC:91888) [Dani...    47   7e-04
gi|7508991|pir||T32840 hypothetical protein W04H10.3 - Caenorhab...    47   7e-04
gi|39586290|emb|CAE66701.1| Hypothetical protein CBG12046 [Caeno...    47   7e-04
gi|28804294|dbj|BAC58029.1| probable RING-B-box-coiled coil prot...    47   7e-04
gi|32564296|ref|NP_493768.3| NHL domain containing (nhl-3) [Caen...    47   7e-04
gi|28837282|gb|AAH47564.1| TRIM6 protein [Homo sapiens]                47   7e-04
gi|34883226|ref|XP_347343.1| similar to CG15105-PA [Rattus norve...    47   0.001
gi|39586244|emb|CAE66655.1| Hypothetical protein CBG11992 [Caeno...    47   0.001
gi|17553362|ref|NP_497169.1| predicted CDS, tripartite motif pro...    47   0.001
gi|40385887|ref|NP_954706.1| malin; NHL repeat containing 1 [Rat...    47   0.001
gi|12275878|gb|AAG50174.1| tripartite motif protein TRIM26 alpha...    47   0.001
gi|15147232|ref|NP_109623.4| tripartite motif protein 26; zinc f...    47   0.001
gi|50401661|sp|Q99PN3|TM26_MOUSE Tripartite motif-containing pro...    47   0.001
gi|18202956|sp|Q9HCM9|RN23_HUMAN RING finger protein 23 (Testis-...    46   0.001
gi|18079262|ref|NP_477514.1| tripartite motif protein 6 [Homo sa...    46   0.001
gi|33869766|gb|AAH05847.2| TRIM56 protein [Homo sapiens]               46   0.001
gi|48475186|gb|AAT44255.1| unknown protein [Oryza sativa (japoni...    46   0.001
gi|33877724|gb|AAH11882.1| TRIM56 protein [Homo sapiens]               46   0.001
gi|34875159|ref|XP_221125.2| similar to 52 kDa Ro protein (Sjogr...    46   0.001
gi|32880219|ref|NP_872596.1| Sjogren syndrome antigen A1 (52kDa,...    46   0.001
gi|34559853|gb|AAQ75551.1| HSD-34 [Homo sapiens]                       46   0.002
gi|28839681|gb|AAH47945.1| Ring finger protein 36, isoform a [Ho...    46   0.002
gi|21619928|gb|AAH33211.1| Similar to tripartite motif-containin...    46   0.002
gi|47077485|dbj|BAD18630.1| unnamed protein product [Homo sapiens]     46   0.002
gi|39591826|emb|CAE71404.1| Hypothetical protein CBG18314 [Caeno...    45   0.002
gi|34365285|emb|CAE45973.1| hypothetical protein [Homo sapiens]        45   0.002
gi|30794216|ref|NP_112223.1| tripartite motif-containing 56 [Hom...    45   0.002
gi|6677727|ref|NP_033080.1| tripartite motif protein 27; ret fin...    45   0.002
gi|17558890|ref|NP_506602.1| predicted CDS, kelch-like 10 family...    45   0.002
gi|34865435|ref|XP_236463.2| similar to tripartite motif-contain...    45   0.002
gi|21751638|dbj|BAC04004.1| unnamed protein product [Homo sapiens]     45   0.002
gi|39584642|emb|CAE72395.1| Hypothetical protein CBG19552 [Caeno...    45   0.002
gi|37574100|ref|NP_932129.1| RIKEN cDNA F730114J12 [Mus musculus...    45   0.002
gi|50401217|sp|O77666|TM26_PIG Tripartite motif-containing prote...    45   0.002
gi|37547504|ref|XP_086409.5| KIAA2025 protein [Homo sapiens]           45   0.003
gi|50754723|ref|XP_414478.1| PREDICTED: similar to Zinc finger p...    45   0.003
gi|29747979|gb|AAH50815.1| Ring finger protein 36 [Mus musculus]       45   0.003
gi|39589874|emb|CAE60872.1| Hypothetical protein CBG04583 [Caeno...    45   0.003
gi|50751154|ref|XP_422281.1| PREDICTED: similar to KIAA2025 prot...    45   0.003
gi|50757133|ref|XP_415394.1| PREDICTED: similar to membrane-asso...    45   0.003
gi|5689533|dbj|BAA83050.1| KIAA1098 protein [Homo sapiens]             45   0.003
gi|46250192|gb|AAH68669.1| MGC81061 protein [Xenopus laevis]           45   0.003
gi|25777694|ref|NP_741983.1| tripartite motif-containing 35 isof...    45   0.003
gi|50511255|dbj|BAD32613.1| mKIAA2025 protein [Mus musculus]           45   0.003
gi|31746567|gb|AAF60661.2| Hypothetical protein Y47G6A.14 [Caeno...    45   0.003
gi|34880785|ref|XP_222801.2| similar to KIAA2025 protein [Rattus...    45   0.003
gi|25777692|ref|NP_055881.1| tripartite motif-containing 35 isof...    45   0.003
gi|33469244|gb|AAQ19671.1| malin [Homo sapiens]                        45   0.004
gi|40255283|ref|NP_940988.2| malin [Homo sapiens] >gnl|BL_ORD_ID...    45   0.004
gi|17563724|ref|NP_506726.1| predicted CDS, SecA-type chloroplas...    45   0.004
gi|21707222|gb|AAH33871.1| TRIM50C protein [Homo sapiens]              45   0.004
gi|6625539|emb|CAB63935.1| putative acid finger protein [Sus scr...    45   0.004
gi|38524612|ref|NP_942150.1| tripartite motif-containing 50C [Ho...    45   0.004
gi|37538597|ref|XP_351724.1| similar to tripartite motif protein...    45   0.004
gi|47211208|emb|CAF90165.1| unnamed protein product [Tetraodon n...    44   0.005
gi|48994833|gb|AAT48107.1| Trim1 beta [Cercopithecus aethiops]         44   0.005
gi|13529425|gb|AAH05447.1| Trim30 protein [Mus musculus]               44   0.005
gi|39588892|emb|CAE69522.1| Hypothetical protein CBG15731 [Caeno...    44   0.005
gi|39584643|emb|CAE72396.1| Hypothetical protein CBG19553 [Caeno...    44   0.005
gi|41053615|ref|NP_956578.1| hypothetical protein MGC56368 [Dani...    44   0.005
gi|50759253|ref|XP_417589.1| PREDICTED: similar to hypothetical ...    44   0.005
gi|30425030|ref|NP_780549.1| malin [Mus musculus] >gnl|BL_ORD_ID...    44   0.005
gi|50756859|ref|XP_415328.1| PREDICTED: similar to Tripartite mo...    44   0.005
gi|48994831|gb|AAT48106.1| Trim1 alpha [Cercopithecus aethiops]        44   0.005
gi|12407363|gb|AAG53470.1| tripartite motif protein [Mus musculus]     44   0.006
gi|91257|pir||A30891 regulatory protein rpt-1 - mouse                  44   0.006
gi|50756861|ref|XP_415329.1| PREDICTED: similar to tripartite mo...    44   0.006
gi|26324804|dbj|BAC26156.1| unnamed protein product [Mus musculu...    44   0.006
gi|47218749|emb|CAG02735.1| unnamed protein product [Tetraodon n...    44   0.006
gi|20141865|sp|P15533|TM30_MOUSE Tripartite motif protein 30 (Do...    44   0.006
gi|34853881|ref|XP_231249.2| similar to CG16807-PA [Rattus norve...    44   0.006
gi|9837125|gb|AAG00432.1| membrane-associated nucleic acid bindi...    44   0.006
gi|34785654|gb|AAH57094.1| Unknown (protein for MGC:73514) [Mus ...    44   0.006
gi|27881691|gb|AAH44642.1| Unknown (protein for MGC:52176) [Homo...    44   0.006
gi|21594048|gb|AAM65966.1| unknown [Arabidopsis thaliana]              44   0.006
gi|18409246|ref|NP_564959.1| zinc finger (C3HC4-type RING finger...    44   0.006
gi|37622899|ref|NP_060543.5| ring finger protein 137; SSA protei...    44   0.006
gi|16923932|gb|AAL31641.1| Ro/SSA1 related protein FLJ10369 [Hom...    44   0.006
gi|15982946|gb|AAL11501.1| SSA protein SS-56 [Homo sapiens]            44   0.006
gi|49077394|ref|XP_402562.1| hypothetical protein UM04947.1 [Ust...    44   0.006
gi|38074631|ref|XP_130233.3| membrane-associated nucleic acid bi...    44   0.006
gi|39591332|emb|CAE73385.1| Hypothetical protein CBG20825 [Caeno...    44   0.006
gi|41149614|ref|XP_370644.1| similar to tripartite motif-contain...    44   0.006
gi|28484812|ref|XP_286106.1| similar to ring finger protein 129 ...    44   0.006
gi|6677815|ref|NP_033125.1| tripartite motif protein 30; regulat...    44   0.006
gi|47215426|emb|CAG01123.1| unnamed protein product [Tetraodon n...    44   0.006
gi|47228275|emb|CAG07670.1| unnamed protein product [Tetraodon n...    44   0.008
gi|22749455|ref|NP_689950.1| hypothetical protein MGC33993 [Homo...    44   0.008
gi|21748764|dbj|BAC03481.1| unnamed protein product [Homo sapiens]     44   0.008
gi|27680501|ref|XP_219409.1| similar to hypothetical protein FLJ...    44   0.008
gi|38090370|ref|XP_136908.3| similar to RIKEN cDNA 2310035M22 [M...    44   0.008
gi|17529236|gb|AAL38845.1| putative SecA-type chloroplast protei...    44   0.008
gi|25518647|pir||F86349 hypothetical protein F8K7.7 [imported] -...    44   0.008
gi|15219056|ref|NP_173584.1| preprotein translocase secA family ...    44   0.008
gi|47206520|emb|CAF95730.1| unnamed protein product [Tetraodon n...    43   0.010
gi|30583585|gb|AAP36037.1| ring finger protein 28 [Homo sapiens]       43   0.010
gi|12407361|gb|AAG53469.1| tripartite motif protein TRIM30 isofo...    43   0.010
gi|48994835|gb|AAT48108.1| Trim1 beta [Aotus trivirgatus]              43   0.010
gi|283833|pir||A43906 nuclear phosphoprotein xnf7 - African claw...    43   0.010
gi|13171051|emb|CAC33173.1| ring finger protein 28 [Homo sapiens]      43   0.010
gi|15221223|ref|NP_177577.1| zinc finger (C3HC4-type RING finger...    43   0.010
gi|21592563|gb|AAM64512.1| putative RING zinc finger protein [Ar...    43   0.010
gi|50805923|ref|XP_424369.1| PREDICTED: similar to muscle specif...    43   0.010
gi|30585235|gb|AAP36890.1| Homo sapiens ring finger protein 28 [...    43   0.010
gi|19924163|ref|NP_115977.2| muscle specific ring finger protein...    43   0.010
gi|50417175|gb|AAH78201.1| Unknown (protein for MGC:101050) [Dan...    43   0.013
gi|39589375|emb|CAE74404.1| Hypothetical protein CBG22136 [Caeno...    43   0.013
gi|39580294|emb|CAE73081.1| Hypothetical protein CBG20457 [Caeno...    43   0.013
gi|37541445|ref|XP_061890.8| similar to tripartite motif-contain...    43   0.013
gi|38344689|emb|CAD40247.2| OSJNBb0096E05.11 [Oryza sativa (japo...    43   0.013
gi|6754694|ref|NP_035975.1| midline 2 [Mus musculus] >gnl|BL_ORD...    42   0.018
gi|50344922|ref|NP_001002133.1| zgc:86757 [Danio rerio] >gnl|BL_...    42   0.018
gi|15617548|ref|NP_258348.1| zinc finger protein CG30 [Spodopter...    42   0.018
gi|47195169|emb|CAF94043.1| unnamed protein product [Tetraodon n...    42   0.018
gi|32425788|gb|AAH53494.1| Trim35 protein [Mus musculus]               42   0.023
gi|30584925|gb|AAP36724.1| Homo sapiens midline 2 [synthetic con...    42   0.023
gi|39578793|emb|CAE56161.1| Hypothetical protein CBG23781 [Caeno...    42   0.023
gi|12861463|dbj|BAB32205.1| unnamed protein product [Mus musculus]     42   0.023
gi|21362275|ref|NP_084255.1| tripartite motif-containing 35 [Mus...    42   0.023
gi|26344746|dbj|BAC36022.1| unnamed protein product [Mus musculus]     42   0.023
gi|16445409|ref|NP_438112.1| midline 2 isoform 2; tripartite mot...    42   0.023
gi|33878170|gb|AAH21259.1| LOC201292 protein [Homo sapiens]            42   0.023
gi|34881561|ref|XP_343826.1| similar to midline 2 protein [Rattu...    42   0.023
gi|17736769|emb|CAD19102.1| dJ820B18.2 (midline 1 (Opitz/BBB syn...    42   0.023
gi|37360240|dbj|BAC98098.1| mKIAA1098 protein [Mus musculus]           42   0.023
gi|6912504|ref|NP_036348.1| midline 2 isoform 1; tripartite moti...    42   0.023
gi|38679905|ref|NP_775818.2| hypothetical protein LOC201292 [Hom...    42   0.023
gi|29294715|gb|AAH49105.1| Trim35 protein [Mus musculus]               42   0.023
gi|26328447|dbj|BAC27962.1| unnamed protein product [Mus musculus]     42   0.023
gi|20270353|ref|NP_620155.1| tripartite motif-containing 43 [Hom...    42   0.030
gi|34872516|ref|XP_216592.2| similar to hypothetical protein FLJ...    42   0.030
gi|17563664|ref|NP_506687.1| membrane-associated nucleic acid bi...    42   0.030
gi|7582298|gb|AAF64269.1| BM-013 [Homo sapiens]                        42   0.030
gi|39545577|ref|NP_057710.2| ring finger and KH domain containin...    42   0.030
gi|34932367|ref|XP_225735.2| similar to KIAA2031 protein [Rattus...    42   0.030
gi|38084060|ref|XP_140436.5| similar to KIAA2031 protein [Mus mu...    42   0.030
gi|26338478|dbj|BAC32910.1| unnamed protein product [Mus musculus]     42   0.030
gi|41124489|ref|XP_371536.1| similar to tripartite motif-contain...    41   0.039
gi|47220874|emb|CAG03081.1| unnamed protein product [Tetraodon n...    41   0.039
gi|50311213|ref|XP_455630.1| unnamed protein product [Kluyveromy...    41   0.039
gi|47208912|emb|CAF93116.1| unnamed protein product [Tetraodon n...    41   0.039
gi|50752130|ref|XP_422667.1| PREDICTED: similar to KIAA0794 prot...    41   0.039
gi|17505504|ref|NP_491737.1| RING zinc finger containing protein...    41   0.039
gi|39588890|emb|CAE69520.1| Hypothetical protein CBG15729 [Caeno...    41   0.039
gi|38086920|ref|XP_195255.2| similar to hypothetical protein FLJ...    41   0.039
gi|50257641|gb|EAL20346.1| hypothetical protein CNBF1570 [Crypto...    41   0.039
gi|17553966|ref|NP_499375.1| RING and zinc finger protein requir...    41   0.051
gi|47227681|emb|CAG09678.1| unnamed protein product [Tetraodon n...    41   0.051
gi|31043796|emb|CAA97810.2| Hypothetical protein M142.6 [Caenorh...    41   0.051
gi|15021445|gb|AAK77722.1| ORF53, gene family 7 [shrimp white sp...    41   0.051
gi|47215415|emb|CAG01112.1| unnamed protein product [Tetraodon n...    41   0.051
gi|17158167|ref|NP_477585.1| wsv063 [shrimp white spot syndrome ...    41   0.051
gi|18266714|ref|NP_543179.1| ring finger protein 28; muscle ring...    41   0.051
gi|17554300|ref|NP_499403.1| putative protein, with 2 coiled coi...    41   0.051
gi|38078883|ref|XP_131731.3| similar to ring finger protein 28; ...    41   0.051
gi|41201048|ref|XP_210184.4| similar to tripartite motif-contain...    41   0.051
gi|50540516|ref|NP_001002723.1| zgc:92594 [Danio rerio] >gnl|BL_...    41   0.051
gi|7505080|pir||T23197 hypothetical protein K01G5.1 - Caenorhabd...    41   0.051
gi|47222745|emb|CAG01712.1| unnamed protein product [Tetraodon n...    41   0.051
gi|50757927|ref|XP_425362.1| PREDICTED: similar to RIKEN cDNA 99...    41   0.051
gi|29244234|ref|NP_808410.1| hypothetical protein 4933403D14 [Mu...    41   0.051
gi|40353773|ref|NP_056246.2| BIA2 protein [Homo sapiens]               40   0.067
gi|9629493|ref|NP_044724.1| hypothetical protein DaV1gp27 [Duck ...    40   0.067
gi|47212248|emb|CAF93161.1| unnamed protein product [Tetraodon n...    40   0.067
gi|17540438|ref|NP_501814.1| predicted CDS, putative nuclear pro...    40   0.067
gi|17553358|ref|NP_497167.1| predicted CDS, zinc-finger protein ...    40   0.067
gi|47222746|emb|CAG01713.1| unnamed protein product [Tetraodon n...    40   0.067
gi|47207992|emb|CAF91694.1| unnamed protein product [Tetraodon n...    40   0.067
gi|47228165|emb|CAF97794.1| unnamed protein product [Tetraodon n...    40   0.067
gi|17510013|ref|NP_491164.1| RING zinc finger containing protein...    40   0.067
gi|34147266|ref|NP_899027.1| hypothetical protein C630023L15 [Mu...    40   0.087
gi|6323276|ref|NP_013348.1| Hypothetical ORF; Ylr247cp [Saccharo...    40   0.087
gi|15218042|ref|NP_173506.1| zinc finger (C3HC4-type RING finger...    40   0.087
gi|50757528|ref|XP_415552.1| PREDICTED: similar to hypothetical ...    40   0.087
gi|34871437|ref|XP_220473.2| similar to hypothetical protein [Ra...    40   0.087
gi|31981243|ref|NP_075713.2| Casitas B-lineage lymphoma c [Mus m...    40   0.087
gi|41054063|ref|NP_956172.1| Unknown (protein for MGC:63737); wu...    40   0.087
gi|41235779|ref|NP_958761.1| similar to tripartite motif-contain...    40   0.087
gi|28278996|gb|AAH45615.1| A130009K11Rik protein [Mus musculus]        40   0.087
gi|20340241|gb|AAM19707.1| putative RING zinc finger protein-lik...    40   0.087
gi|31205499|ref|XP_311701.1| ENSANGP00000015141 [Anopheles gambi...    40   0.087
gi|9506663|ref|NP_061935.1| hypothetical protein FLJ20225 [Homo ...    40   0.087
gi|6754692|ref|NP_034927.1| midline 1 [Mus musculus] >gnl|BL_ORD...    40   0.11
gi|12621082|ref|NP_075216.1| midline 1; Finger on X and Y (in ra...    40   0.11
gi|14279435|gb|AAK58598.1| midline-1 [Gallus gallus]                   40   0.11
gi|7513805|pir||T09013 RING finger protein Fxy - mouse >gnl|BL_O...    40   0.11
gi|45383848|ref|NP_989460.1| midline 1 (Opitz/BBB syndrome) [Gal...    40   0.11
gi|13160389|emb|CAC32842.1| ring finger protein 30 [Homo sapiens]      40   0.11
gi|34878860|ref|NP_115935.2| ring finger protein 30 isoform 1; m...    40   0.11
gi|28374186|gb|AAH46337.1| Casitas B-lineage lymphoma c [Mus mus...    40   0.11
gi|1488047|gb|AAB05873.1| RING finger protein                          40   0.11
gi|47939778|gb|AAH72221.1| MGC81405 protein [Xenopus laevis]           40   0.11
gi|23943803|ref|NP_705724.1| RIKEN cDNA 5830442J12 [Mus musculus...    40   0.11
gi|31565626|gb|AAH53704.1| Mid1 protein [Mus musculus]                 40   0.11
gi|34855327|ref|XP_214861.2| similar to Casitas B-lineage lympho...    40   0.11
gi|13160388|emb|CAC32841.1| ring finger protein 30 [Homo sapiens]      40   0.11
gi|34878870|ref|NP_912730.1| ring finger protein 30 isoform 2; m...    40   0.11
gi|27671264|ref|XP_224885.1| similar to tripartite motif-contain...    39   0.15
gi|50758336|ref|XP_415872.1| PREDICTED: similar to POB1 [Gallus ...    39   0.15
gi|23271192|gb|AAH36012.1| TRIM37 protein [Homo sapiens]               39   0.15
gi|15147333|ref|NP_056109.1| tripartite motif-containing 37; MUL...    39   0.15
gi|17221827|gb|AAL36460.1| POB1 [Homo sapiens]                         39   0.15
gi|22653813|sp|P82457|MID1_MUSSP Midline 1 protein (Tripartite m...    39   0.15
gi|47222920|emb|CAF99076.1| unnamed protein product [Tetraodon n...    39   0.15
gi|34862988|ref|XP_343027.1| similar to RING-finger protein MURF...    39   0.15
gi|26006225|dbj|BAC41455.1| mKIAA0898 protein [Mus musculus]           39   0.15
gi|4240285|dbj|BAA74921.1| KIAA0898 protein [Homo sapiens]             39   0.15
gi|28828505|gb|AAO51113.1| similar to Dictyostelium discoideum (...    39   0.15
gi|17531257|ref|NP_494235.1| predicted CDS, putative protein, wi...    39   0.15
gi|37574064|ref|NP_932104.1| tripartite motif protein 37 [Mus mu...    39   0.15
gi|50539776|ref|NP_001002358.1| zgc:92123 [Danio rerio] >gnl|BL_...    39   0.15
gi|38091370|ref|XP_111186.2| similar to hypothetical protein [Mu...    39   0.15
gi|46249651|gb|AAH68934.1| LOC397847 protein [Xenopus laevis]          39   0.15
gi|45383782|ref|NP_989500.1| breast cancer 1, early onset [Gallu...    39   0.15
gi|38110106|gb|EAA55875.1| hypothetical protein MG01526.4 [Magna...    39   0.19
gi|6686035|sp|Q13114|TRA3_HUMAN TNF receptor associated factor 3...    39   0.19
gi|22027616|ref|NP_003291.2| TNF receptor-associated factor 3 is...    39   0.19
gi|595911|gb|AAA56753.1| CD40 binding protein [Homo sapiens]           39   0.19
gi|39591791|emb|CAE71369.1| Hypothetical protein CBG18273 [Caeno...    39   0.19
gi|12667358|gb|AAK01405.1| CBLC protein [Mus musculus]                 39   0.19
gi|34873607|ref|XP_346408.1| hypothetical protein XP_346407 [Rat...    39   0.19
gi|33416737|gb|AAH56131.1| MGC69169 protein [Xenopus laevis]           39   0.19
gi|13991704|gb|AAK51467.1| UbcM4-interacting protein 5 [Mus musc...    39   0.19
gi|31543595|ref|NP_542129.2| ubiquitin conjugating enzyme 7 inte...    39   0.19
gi|19263856|gb|AAH25068.1| C330018L13Rik protein [Mus musculus]        39   0.19
gi|49899992|gb|AAH76998.1| Unknown (protein for MGC:89632) [Xeno...    39   0.19
gi|1699382|gb|AAB37501.1| Brca1 [Rattus norvegicus] >gnl|BL_ORD_...    39   0.19
gi|47940004|gb|AAH72370.1| MGC84499 protein [Xenopus laevis]           39   0.19
gi|31542779|ref|NP_848651.2| hypothetical protein FLJ36180 [Homo...    39   0.19
gi|46437312|gb|EAK96661.1| hypothetical protein CaO19.9527 [Cand...    39   0.19
gi|34873114|ref|XP_233724.2| similar to RIKEN cDNA 9430015G10 [R...    39   0.19
gi|47219203|emb|CAG11221.1| unnamed protein product [Tetraodon n...    39   0.19
gi|22027620|ref|NP_663778.1| TNF receptor-associated factor 3 is...    39   0.19
gi|7512333|pir||S68467 CD40 receptor-associated protein CAP-1 - ...    39   0.19
gi|28416345|gb|AAO42645.1| LD34250p [Drosophila melanogaster]          39   0.19
gi|24641851|ref|NP_572915.1| CG9941-PA [Drosophila melanogaster]...    39   0.19
gi|50306103|ref|XP_453013.1| unnamed protein product [Kluyveromy...    39   0.19
gi|47215450|emb|CAF97011.1| unnamed protein product [Tetraodon n...    39   0.25
gi|13775218|ref|NP_112587.1| similar to mouse 1110061N23Rik prot...    39   0.25
gi|6552313|ref|NP_009232.1| breast cancer 1, early onset isoform...    39   0.25
gi|30466260|ref|NP_848668.1| breast cancer 1, early onset [Bos t...    39   0.25
gi|6552307|ref|NP_009229.1| breast cancer 1, early onset isoform...    39   0.25
gi|6552319|ref|NP_009235.1| breast cancer 1, early onset isoform...    39   0.25
gi|48479020|gb|AAT44834.1| breast cancer type 1 [Pongo pygmaeus]       39   0.25
gi|38503185|sp|Q9GKK8|BRC1_PANTR Breast cancer type 1 susceptibi...    39   0.25
gi|3462505|gb|AAC32999.1| midline 1 cerebellar isoform 2 [Homo s...    39   0.25
gi|49115787|gb|AAH73534.1| Unknown (protein for IMAGE:5440184) [...    39   0.25
gi|6552299|ref|NP_009225.1| breast cancer 1, early onset; breast...    39   0.25
gi|48479018|gb|AAT44833.1| breast cancer type 1 [Macaca mulatta]       39   0.25
gi|37953275|gb|AAR04849.1| BRCA1 [Pan troglodytes]                     39   0.25


>gi|25395437|pir||D88072 protein ZK1240.1 [imported] - Caenorhabditis
            elegans
          Length = 412

 Score =  593 bits (1528), Expect = e-168
 Identities = 304/354 (85%), Positives = 304/354 (85%), Gaps = 17/354 (4%)
 Frame = +1

Query: 1    MPTYYNQFLRNSHEPVKIVINWKFVSTRSQPPEMSKVIECEICNLEFSSVNEDQVPRILK 180
            MPTYYNQFLRNSHEPVKIVINWKFVSTRSQPPEMSKVIECEICNLEFSSVNEDQVPRILK
Sbjct: 1    MPTYYNQFLRNSHEPVKIVINWKFVSTRSQPPEMSKVIECEICNLEFSSVNEDQVPRILK 60

Query: 181  CGHSVCQCCATKLLKNSAISCPFCRETTSVSAVKDLQKNFALLQIIEHTKTERVEEEDEA 360
            CGHSVCQCCATKLLKNSAISCPFCRETTSVSAVKDLQKNFALLQIIEHTKTERVEEEDEA
Sbjct: 61   CGHSVCQCCATKLLKNSAISCPFCRETTSVSAVKDLQKNFALLQIIEHTKTERVEEEDEA 120

Query: 361  DVPPKCATHKYNMAEFVCLDPNCSSDEKLMCRTCEEFGVHAGHSKGLLQTEAXXXXXXXX 540
            DVPPKCATHKYNMAEFVCLDPNCSSDEKLMCRTCEEFGVHAGHSKGLLQTEA
Sbjct: 121  DVPPKCATHKYNMAEFVCLDPNCSSDEKLMCRTCEEFGVHAGHSKGLLQTEALKLRTLLK 180

Query: 541  XXXXXSEDQIVQIDKNIEEVDSAQQTNQVDGKVFQDKKDLISVYYTSIRETLDAQEALAN 720
                 SEDQIVQIDKNIEEVDSAQQTNQVDGKVFQDKKDLISVYYTSIRETLDAQEALAN
Sbjct: 181  DKLLKSEDQIVQIDKNIEEVDSAQQTNQVDGKVFQDKKDLISVYYTSIRETLDAQEALAN 240

Query: 721  QKLREIXXXXXXXXXXXXXXXXXXXXTQKLKNEKLKSFLGMSNADLLALNSEIQLWDDSE 900
            QKLREI                    TQKLKNEKLKSFLGMSNADLLALNSEIQLWDDSE
Sbjct: 241  QKLREIAESNSASNKLLLEELSESLETQKLKNEKLKSFLGMSNADLLALNSEIQLWDDSE 300

Query: 901  NTEVEPIQFDVALNFPEVNRLA-----------------VDVANASMSSSLEPD 1011
            NTEVEPIQFDVALNFPEVNRLA                 VDVANASMSSSLEPD
Sbjct: 301  NTEVEPIQFDVALNFPEVNRLAVGKWIWKEVGRSMSGSFVDVANASMSSSLEPD 354




[DB home][top]