Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK1248_12
(876 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74) [... 268 1e-70
gi|39596974|emb|CAE59201.1| Hypothetical protein CBG02512 [Caeno... 248 2e-64
gi|25395729|pir||H88449 protein F54D8.1 [imported] - Caenorhabdi... 140 5e-32
gi|17553572|ref|NP_498086.1| collagen alpha precursor, DumPY : s... 140 5e-32
gi|39583250|emb|CAE60042.1| Hypothetical protein CBG03553 [Caeno... 138 1e-31
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 63 7e-09
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 55 2e-06
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 54 3e-06
gi|687634|gb|AAA62504.1| collagen 53 8e-06
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno... 53 8e-06
gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically twis... 52 2e-05
gi|115410|sp|P12114|CCS1_CAEEL Cuticle collagen sqt-1 >gnl|BL_OR... 51 4e-05
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 47 6e-04
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 47 7e-04
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 47 7e-04
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 46 0.001
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 46 0.001
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 46 0.001
gi|17569903|ref|NP_508386.1| COLlagen structural gene (38.6 kD) ... 45 0.002
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 45 0.002
gi|39597491|emb|CAE59721.1| Hypothetical protein CBG03154 [Caeno... 45 0.003
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 45 0.003
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 44 0.005
gi|39597664|emb|CAE68355.1| Hypothetical protein CBG14092 [Caeno... 44 0.005
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 44 0.006
gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ... 44 0.006
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 44 0.006
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 43 0.008
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 42 0.018
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 42 0.023
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 41 0.030
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 41 0.040
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 41 0.040
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno... 41 0.040
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 41 0.040
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [... 41 0.040
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 40 0.052
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 40 0.068
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col... 40 0.088
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 39 0.12
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 39 0.12
gi|47087417|ref|NP_998603.1| zgc:55668 [Danio rerio] >gnl|BL_ORD... 39 0.12
gi|17568307|ref|NP_509837.1| COLlagen structural gene (col-177) ... 39 0.12
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (... 39 0.15
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita] 39 0.15
gi|29247345|gb|EAA38910.1| GLP_435_33020_30552 [Giardia lamblia ... 39 0.15
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno... 39 0.20
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 39 0.20
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 39 0.20
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 39 0.20
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 39 0.20
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 38 0.26
gi|34852864|ref|XP_345114.1| procollagen, type X, alpha 1 [Rattu... 38 0.26
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 38 0.26
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 38 0.26
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut... 38 0.34
gi|382658|prf||1819485A CENP-E protein 38 0.34
gi|50731940|ref|XP_418425.1| PREDICTED: similar to collagen, typ... 37 0.44
gi|17535069|ref|NP_496535.1| COLlagen structural gene (col-84) [... 37 0.44
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 37 0.57
gi|48096868|ref|XP_394789.1| similar to CG9170-PA [Apis mellifera] 37 0.57
gi|49523150|gb|AAH75409.1| Unknown (protein for MGC:89161) [Xeno... 37 0.57
gi|902016|gb|AAB17102.1| EmmL2(A207) [Streptococcus pyogenes] 37 0.57
gi|4883489|gb|AAD31543.1| polyprotein [GB virus C variant troglo... 37 0.57
gi|3044185|gb|AAC13303.1| mature parasite-infected erythrocyte s... 37 0.57
gi|21955276|ref|NP_611059.1| CG30084-PB [Drosophila melanogaster... 37 0.75
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno... 37 0.75
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 37 0.75
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [... 37 0.75
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 37 0.75
gi|50309061|ref|XP_454536.1| unnamed protein product [Kluyveromy... 37 0.75
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 37 0.75
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 37 0.75
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno... 37 0.75
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 36 0.98
gi|39597161|emb|CAE59388.1| Hypothetical protein CBG02745 [Caeno... 36 0.98
gi|23508016|ref|NP_700686.1| 10b antigen, putative [Plasmodium f... 36 0.98
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ... 36 0.98
gi|50751436|ref|XP_422397.1| PREDICTED: similar to hypothetical ... 36 0.98
gi|30721677|gb|AAP33688.1| phoshoprotein 300 [Plasmodium falcipa... 36 0.98
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 36 0.98
gi|33241323|ref|NP_876265.1| Ribosomal protein S6 [Prochlorococc... 36 0.98
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 36 0.98
gi|23613679|ref|NP_704700.1| transporter, putative [Plasmodium f... 36 0.98
gi|23613032|ref|NP_703354.1| Mature parasite-infected erythrocyt... 36 0.98
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 36 0.98
gi|40215891|gb|AAR82795.1| LD07113p [Drosophila melanogaster] 36 1.3
gi|49481763|ref|YP_037329.1| surface protein, LPXTG-motif cell w... 36 1.3
gi|21401137|ref|NP_657122.1| V_ATPase_sub_a, V-type ATPase 116kD... 36 1.3
gi|42782320|ref|NP_979567.1| LPXTG-motif cell wall anchor domain... 36 1.3
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 36 1.3
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 36 1.3
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 36 1.3
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C... 36 1.3
gi|39586931|emb|CAE62866.1| Hypothetical protein CBG07049 [Caeno... 36 1.3
gi|34880092|ref|XP_228956.2| similar to thyroid hormone receptor... 36 1.3
gi|31240941|ref|XP_320884.1| ENSANGP00000019179 [Anopheles gambi... 36 1.3
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 36 1.3
gi|28317255|gb|AAL68158.2| AT30755p [Drosophila melanogaster] 36 1.3
gi|30021331|ref|NP_832962.1| surface protein [Bacillus cereus AT... 36 1.3
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [... 36 1.3
gi|24648969|ref|NP_732725.1| CG31169-PA [Drosophila melanogaster... 36 1.3
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 36 1.3
gi|45551945|ref|NP_732726.2| CG31169-PB [Drosophila melanogaster... 36 1.3
gi|47218355|emb|CAG04187.1| unnamed protein product [Tetraodon n... 36 1.3
gi|46228483|gb|EAK89353.1| hypothetical protein cgd8_1380 [Crypt... 35 1.7
gi|23613722|ref|NP_704743.1| hypothetical protein [Plasmodium fa... 35 1.7
gi|6753480|ref|NP_034055.1| procollagen, type X, alpha 1 [Mus mu... 35 1.7
gi|420192|pir||S31216 collagen alpha 1(X) chain precursor - mous... 35 1.7
gi|17506859|ref|NP_491822.1| predicted CDS, COLlagen structural ... 35 1.7
gi|41152468|ref|NP_956226.1| Unknown (protein for MGC:73333); wu... 35 1.7
gi|667031|emb|CAA46237.1| alpha1 (X) collagen [Mus musculus] 35 1.7
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 35 1.7
gi|34531631|dbj|BAC86188.1| unnamed protein product [Homo sapiens] 35 1.7
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 35 1.7
gi|11497346|ref|NP_051450.1| ErpQ [Borrelia burgdorferi B31] >gn... 35 1.7
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ... 35 2.2
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ... 35 2.2
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 35 2.2
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl... 35 2.2
gi|17534799|ref|NP_493702.1| COLlagen structural gene (col-69) [... 35 2.2
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 35 2.2
gi|37590208|gb|AAH59032.1| Cenpe protein [Mus musculus] 35 2.2
gi|40789293|ref|NP_776123.2| centromere protein E; kinesin 10; k... 35 2.2
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ... 35 2.2
gi|24954561|gb|AAN64677.1| M protein [Streptococcus pyogenes] 35 2.2
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 35 2.2
gi|17507511|ref|NP_492619.1| COLlagen structural gene (col-64) [... 35 2.2
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 35 2.2
gi|23508683|ref|NP_701352.1| antigen 332, putative [Plasmodium f... 35 2.2
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [... 35 2.8
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 35 2.8
gi|23509422|ref|NP_702089.1| hypothetical protein [Plasmodium fa... 35 2.8
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ... 35 2.8
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno... 35 2.8
gi|39593808|emb|CAE62101.1| Hypothetical protein CBG06131 [Caeno... 35 2.8
gi|50426861|ref|XP_462028.1| unnamed protein product [Debaryomyc... 35 2.8
gi|23508992|ref|NP_701660.1| hypothetical protein [Plasmodium fa... 35 2.8
gi|50546232|ref|XP_500637.1| hypothetical protein [Yarrowia lipo... 35 2.8
gi|14029007|gb|AAK52548.1| Putative myosin heavy chain-like [Ory... 35 2.8
gi|37595258|gb|AAQ94514.1| M protein [Streptococcus pyogenes] 35 2.8
gi|47226236|emb|CAG08383.1| unnamed protein product [Tetraodon n... 35 2.8
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 35 2.8
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 35 2.8
gi|34785861|gb|AAH57638.1| Unknown (protein for MGC:67773) [Mus ... 35 2.8
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno... 35 2.8
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 35 2.8
gi|25372787|pir||C96597 Rubisco subunit binding-protein beta sub... 34 3.7
gi|18405397|ref|NP_564692.1| expressed protein [Arabidopsis thal... 34 3.7
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 34 3.7
gi|33598984|gb|AAQ23117.1| M73 [Streptococcus pyogenes] 34 3.7
gi|22655493|gb|AAN04082.1| M76 [Streptococcus pyogenes] 34 3.7
gi|34485686|gb|AAQ73228.1| M protein [Streptococcus pyogenes] 34 3.7
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 34 3.7
gi|34879797|ref|XP_235733.2| similar to angiomotin [Rattus norve... 34 3.7
gi|47227283|emb|CAF96832.1| unnamed protein product [Tetraodon n... 34 3.7
gi|17539786|ref|NP_502175.1| COLlagen structural gene (45.3 kD) ... 34 3.7
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [... 34 3.7
gi|23508562|ref|NP_701231.1| hypothetical protein [Plasmodium fa... 34 3.7
gi|39598361|emb|CAE69054.1| Hypothetical protein CBG15063 [Caeno... 34 3.7
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno... 34 3.7
gi|39594909|emb|CAE70777.1| Hypothetical protein CBG17531 [Caeno... 34 3.7
gi|37590922|gb|AAH59696.1| Hdac9 protein [Danio rerio] 34 3.7
gi|39589826|emb|CAE67061.1| Hypothetical protein CBG12469 [Caeno... 34 3.7
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 34 3.7
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 34 4.8
gi|47222559|emb|CAG02924.1| unnamed protein product [Tetraodon n... 34 4.8
gi|14670381|ref|NP_057427.2| centromere protein F (350/400kD); m... 34 4.8
gi|23480279|gb|EAA16880.1| hypothetical protein [Plasmodium yoel... 34 4.8
gi|7514128|pir||T18532 serine/threoine protein kinase - guinea p... 34 4.8
gi|30095|emb|CAA42933.1| collagen subunit (alpha-1 (X)) 3 [Homo ... 34 4.8
gi|18105032|ref|NP_000484.2| collagen, type X, alpha 1 precursor... 34 4.8
gi|42784018|ref|NP_981265.1| S-layer homology domain protein [Ba... 34 4.8
gi|1345731|sp|P49454|CENF_HUMAN CENP-F kinetochore protein (Cent... 34 4.8
gi|17559190|ref|NP_506146.1| putative protein, with 2 coiled coi... 34 4.8
gi|560151|emb|CAA46236.1| alpha1(X)collagen [Homo sapiens] 34 4.8
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 34 4.8
gi|39587788|emb|CAE67806.1| Hypothetical protein CBG13384 [Caeno... 34 4.8
gi|47205908|emb|CAF92295.1| unnamed protein product [Tetraodon n... 34 4.8
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 34 4.8
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 34 4.8
gi|19879404|gb|AAK85118.1| non-muscle myosin II heavy chain [Lol... 33 6.3
gi|17508941|ref|NP_491800.1| COLlagen structural gene (col-56) [... 33 6.3
gi|10764194|gb|AAG22598.1| alpha 1 type X collagen [Oryctolagus ... 33 6.3
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD... 33 6.3
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens] 33 6.3
gi|32172768|gb|AAH53712.1| Fyco1 protein [Mus musculus] 33 6.3
gi|388714|gb|AAA89196.1| type VII collagen 33 6.3
gi|47214620|emb|CAG01461.1| unnamed protein product [Tetraodon n... 33 6.3
gi|24581820|ref|NP_723044.1| CG4145-PA [Drosophila melanogaster]... 33 6.3
gi|974435|gb|AAA75179.1| erythrocyte-binding antigen-175 33 6.3
gi|495866|gb|AAA58965.1| collagen type VII [Homo sapiens] 33 6.3
gi|42522144|ref|NP_967524.1| hypothetical protein predicted by G... 33 6.3
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno... 33 6.3
gi|17551340|ref|NP_509274.1| DumPY : shorter than wild-type DPY-... 33 6.3
gi|38455784|gb|AAR20893.1| complement C1qC [Sus scrofa] 33 6.3
gi|1352334|sp|P19214|EBA1_PLAFC Erythrocyte-binding antigen EBA-... 33 6.3
gi|41053497|ref|NP_957110.1| histone deacetylase 9 [Danio rerio]... 33 6.3
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 33 6.3
gi|8099646|gb|AAF72186.1| erythrocyte binding antigen 175; EBA-1... 33 6.3
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens] 33 6.3
gi|15384260|gb|AAK96216.1| erythrocyte-binding antigen-175 [Plas... 33 6.3
gi|4502961|ref|NP_000085.1| alpha 1 type VII collagen precursor;... 33 6.3
gi|627406|pir||A54849 collagen alpha 1(VII) chain precursor - human 33 6.3
gi|115310|sp|P08120|CA14_DROME Collagen alpha 1(IV) chain precur... 33 6.3
gi|30019580|ref|NP_831211.1| Cell wall endopeptidase, family M23... 33 6.3
gi|22779868|ref|NP_683727.1| FYVE and coiled-coil domain contain... 33 6.3
gi|17569345|ref|NP_510110.1| COLlagen structural gene (col-182) ... 33 6.3
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 33 6.3
gi|23612676|ref|NP_704237.1| erythrocyte binding antigen [Plasmo... 33 6.3
gi|15792379|ref|NP_282202.1| putative mismatch repair protein [C... 33 6.3
gi|160283|gb|AAA29600.1| erythrocyte binding protein 33 6.3
gi|50552886|ref|XP_503853.1| hypothetical protein [Yarrowia lipo... 33 6.3
gi|23508398|ref|NP_701067.1| hypothetical protein [Plasmodium fa... 33 8.3
gi|37498975|gb|AAQ91578.1| collagen-like protein 3 [Streptococcu... 33 8.3
gi|40788907|dbj|BAA13195.2| KIAA0204 protein [Homo sapiens] 33 8.3
gi|13375962|ref|NP_078964.1| chromosome 10 open reading frame 68... 33 8.3
gi|50731147|ref|XP_417189.1| PREDICTED: similar to RIKEN cDNA 28... 33 8.3
gi|34876989|ref|XP_343608.1| similar to alpha-3 type IV collagen... 33 8.3
gi|34860488|ref|XP_345898.1| similar to RIKEN cDNA 2810485I05 [R... 33 8.3
gi|1944185|dbj|BAA19655.1| hSLK [Homo sapiens] 33 8.3
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 33 8.3
gi|47940001|gb|AAH72365.1| MGC83548 protein [Xenopus laevis] 33 8.3
gi|47216521|emb|CAG02172.1| unnamed protein product [Tetraodon n... 33 8.3
gi|38454234|ref|NP_942042.1| collagen, type XXVII, alpha 1; coll... 33 8.3
gi|28972093|dbj|BAC65500.1| mKIAA0204 protein [Mus musculus] 33 8.3
gi|28849885|ref|NP_789806.1| RIKEN cDNA 2810485I05 [Mus musculus... 33 8.3
gi|23508533|ref|NP_701202.1| hypothetical protein [Plasmodium fa... 33 8.3
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ... 33 8.3
gi|45934623|gb|AAM94623.2| putative ammonium transporter AMT1;2 ... 33 8.3
gi|42407463|dbj|BAD10396.1| putative rubisco subunit binding-pro... 33 8.3
gi|13508497|gb|AAF15293.3| erythrocyte membrane-associated giant... 33 8.3
gi|21450779|ref|NP_659473.1| hypothetical protein MGC33887 [Homo... 33 8.3
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [... 33 8.3
gi|28210971|ref|NP_781915.1| putative stage III sporulation prot... 33 8.3
gi|12698147|dbj|BAB21900.1| hypothetical protein [Macaca fascicu... 33 8.3
gi|21704090|ref|NP_663528.1| cDNA sequence BC008163 [Mus musculu... 33 8.3
gi|9588137|emb|CAC00588.1| bA16H23.1.1 (protein kinase KIAA0204 ... 33 8.3
gi|246923|gb|AAB21707.1| antigen 332, Ag332=Pf332 gene clone G1 ... 33 8.3
gi|26332288|dbj|BAC29874.1| unnamed protein product [Mus musculus] 33 8.3
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno... 33 8.3
gi|160033|gb|AAA29456.1| antigen 332 33 8.3
gi|84186|pir||JN0292 antigen 332 - malaria parasite (Plasmodium ... 33 8.3
gi|4741823|gb|AAD28717.1| Ste20-related kinase SMAK [Mus musculus] 33 8.3
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ... 33 8.3
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno... 33 8.3
gi|29747815|gb|AAH50870.1| RIKEN cDNA 2810485I05 [Mus musculus] 33 8.3
>gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74)
[Caenorhabditis elegans]
gi|7510948|pir||T34494 hypothetical protein ZK1248.2 -
Caenorhabditis elegans
gi|862491|gb|AAC71083.1| Collagen protein 74 [Caenorhabditis
elegans]
Length = 291
Score = 268 bits (685), Expect = 1e-70
Identities = 146/291 (50%), Positives = 146/291 (50%)
Frame = +1
Query: 1 MNIEMDAWKFETDSLYRDMQKFGRVKRQYGGYGASGANPTPHGGFPGGASPMNXXXXXXX 180
MNIEMDAWKFETDSLYRDMQKFGRVKRQYGGYGASGANPTPHGGFPGGASPMN
Sbjct: 1 MNIEMDAWKFETDSLYRDMQKFGRVKRQYGGYGASGANPTPHGGFPGGASPMNPGSFPGV 60
Query: 181 XXXXXQFNPTQGGEPNPGGSCNCQADNSCXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXX 360
QFNPTQGGEPNPGGSCNCQADNSC Q
Sbjct: 61 VGVPPQFNPTQGGEPNPGGSCNCQADNSCPAGPAGPKGAQGSDGIDGIPGVPGIDGQDAD 120
Query: 361 XXXXXXXXXXGCFTCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGTXXXXXXXXXXX 540
GCFTC DGT
Sbjct: 121 DAQAQTQQYAGCFTCPQGPQGPQGPQGKPGVRGMRGARGQGAMPGRDGTPGQPGSLGPVG 180
Query: 541 XXXXXXXXXXXXXXXADVEHQVGLPGPKGISXXXXXXXXXXXXXXXXXXXIPGAPGERGP 720
ADVEHQVGLPGPKGIS IPGAPGERGP
Sbjct: 181 PVGPQGEPGSEGEPGADVEHQVGLPGPKGISGPTGQPGDQGPQGDTGAQGIPGAPGERGP 240
Query: 721 RGDKGDXXXXXXXXXXXXXXXXXTDAEYCPCPQRQESAPVNGNQGYKNRRH 873
RGDKGD TDAEYCPCPQRQESAPVNGNQGYKNRRH
Sbjct: 241 RGDKGDNGENGSAGAPGEEGEPGTDAEYCPCPQRQESAPVNGNQGYKNRRH 291