Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK131_7
(369 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17559286|ref|NP_505278.1| predicted CDS, histone (his-52) [Ca... 197 5e-50
gi|17561988|ref|NP_507031.1| histone (his-4) [Caenorhabditis ele... 197 5e-50
gi|17532989|ref|NP_496897.1| histone (his-44) [Caenorhabditis el... 197 5e-50
gi|17561996|ref|NP_505197.1| histone (his-8) [Caenorhabditis ele... 197 5e-50
gi|17538224|ref|NP_502132.1| histone (13.5 kD) (his-48) [Caenorh... 196 1e-49
gi|17558794|ref|NP_505464.1| histone (13.5 kD) (his-41+his-36) [... 194 3e-49
gi|39595176|emb|CAE60213.1| Hypothetical protein CBG03777 [Caeno... 191 4e-48
gi|39581593|emb|CAE58378.1| Hypothetical protein CBG01507 [Caeno... 191 4e-48
gi|39594618|emb|CAE72196.1| Hypothetical protein CBG19304 [Caeno... 190 7e-48
gi|39583631|emb|CAE65735.1| Hypothetical protein CBG10818 [Caeno... 189 9e-48
gi|122051|sp|P21897|H2B_CHITH Histone H2B >gnl|BL_ORD_ID|644694 ... 185 2e-46
gi|38512027|gb|AAH61044.1| Hist1h2bp protein [Mus musculus] 184 3e-46
gi|30061391|ref|NP_835509.1| histone 1, H2bp [Mus musculus] >gnl... 184 3e-46
gi|30061381|ref|NP_835505.1| histone 1, H2bj [Mus musculus] >gnl... 184 3e-46
gi|28316760|ref|NP_783595.1| histone 1, H2bb [Mus musculus] >gnl... 184 3e-46
gi|4504259|ref|NP_003510.1| H2B histone family, member C [Homo s... 184 3e-46
gi|70717|pir||HSXLB1 histone H2B.1 - African clawed frog >gnl|BL... 184 4e-46
gi|229329|prf||701196A histone H2B 184 4e-46
gi|70716|pir||HSBO22 histone H2B - bovine >gnl|BL_ORD_ID|155345 ... 184 4e-46
gi|34876159|ref|XP_225342.2| similar to Histone H2B 291B [Rattus... 184 4e-46
gi|45768638|gb|AAH67485.1| HIST1H2BM protein [Homo sapiens] 184 4e-46
gi|34876166|ref|XP_341531.1| similar to Histone H2B 291B [Rattus... 184 4e-46
gi|20874851|ref|XP_131040.1| similar to Histone H2B 291B [Mus mu... 184 4e-46
gi|4504263|ref|NP_003512.1| H2B histone family, member E [Homo s... 184 4e-46
gi|30061387|ref|NP_835504.1| histone 1, H2bh [Mus musculus] >gnl... 184 4e-46
gi|122023|sp|P02281|H2B1_XENLA Histone H2B.1 >gnl|BL_ORD_ID|1391... 184 4e-46
gi|10800138|ref|NP_066407.1| H2B histone family, member B [Homo ... 184 4e-46
gi|27686409|ref|XP_225384.1| similar to Histone H2B.h (H2B/h) [R... 184 4e-46
gi|422603|pir||S33220 histone H2B.A - African clawed frog >gnl|B... 184 4e-46
gi|4504257|ref|NP_003509.1| H2B histone family, member A [Homo s... 184 4e-46
gi|4504269|ref|NP_003515.1| H2B histone family, member J [Homo s... 184 4e-46
gi|4504261|ref|NP_003511.1| H2B histone family, member D [Homo s... 184 4e-46
gi|280961|pir||A37363 histone H2B, testis - mouse (fragment) >gn... 184 4e-46
gi|27573732|pdb|1KX3|D Chain D, X-Ray Structure Of The Nucleosom... 184 5e-46
gi|223096|prf||0506206A histone H2B 184 5e-46
gi|184086|gb|AAA63192.1| histone H2B.1 184 5e-46
gi|11513400|pdb|1F66|D Chain D, 2.6 A Crystal Structure Of A Nuc... 184 5e-46
gi|50604189|gb|AAH77692.1| Unknown (protein for MGC:89948) [Xeno... 184 5e-46
gi|45767717|gb|AAH67487.1| H2B histone family, member E [Homo sa... 184 5e-46
gi|10800140|ref|NP_066406.1| H2B histone family, member F [Homo ... 184 5e-46
gi|37857711|dbj|BAC99977.1| histone H2B [Rhacophorus schlegelii] 184 5e-46
gi|4504277|ref|NP_003519.1| H2B histone family, member Q; H2B hi... 184 5e-46
gi|16306566|ref|NP_003518.2| histone H2B; H2B histone family, me... 184 5e-46
gi|7387740|sp|Q93080|H2BL_HUMAN Histone H2B.l (H2B/l) >gnl|BL_OR... 184 5e-46
gi|49258870|pdb|1S32|D Chain D, Molecular Recognition Of The Nuc... 184 5e-46
gi|30268542|emb|CAD89678.1| Xenopus laevis-like histone H2B [Exp... 184 5e-46
gi|30089704|ref|NP_783596.1| histone 1, H2bk [Mus musculus] >gnl... 183 6e-46
gi|13386452|ref|NP_084358.1| histone 3, H2ba [Mus musculus] >gnl... 183 6e-46
gi|28173554|ref|NP_778225.1| histone H2B [Homo sapiens] >gnl|BL_... 183 6e-46
gi|34871486|ref|XP_220507.2| similar to histone protein Hist3h2b... 183 6e-46
gi|46049029|ref|NP_996765.1| histone 3, H2bb [Mus musculus] >gnl... 183 6e-46
gi|18105048|ref|NP_542160.1| H2B histone family, member T; histo... 183 8e-46
gi|20336754|ref|NP_066402.2| H2B histone family, member R [Homo ... 182 1e-45
gi|38074331|ref|XP_354742.1| similar to Histone H2B F (H2B 291A)... 182 1e-45
gi|15030326|gb|AAH11440.1| Hist1h2bc protein [Mus musculus] 182 1e-45
gi|122058|sp|P02284|H2B_PATGR Histone H2B, gonadal >gnl|BL_ORD_I... 182 1e-45
gi|31239833|ref|XP_320330.1| ENSANGP00000014150 [Anopheles gambi... 182 1e-45
gi|31196269|ref|XP_307082.1| ENSANGP00000012046 [Anopheles gambi... 182 1e-45
gi|31239831|ref|XP_320329.1| ENSANGP00000014080 [Anopheles gambi... 182 1e-45
gi|34876364|ref|XP_344596.1| similar to CG31613-PA [Rattus norve... 182 1e-45
gi|122026|sp|P23527|H2BN_HUMAN Histone H2B.n (H2B/n) (H2B.2) >gn... 182 1e-45
gi|31194615|ref|XP_306255.1| ENSANGP00000000003 [Anopheles gambi... 182 1e-45
gi|47218414|emb|CAG12685.1| unnamed protein product [Tetraodon n... 182 2e-45
gi|7387738|sp|Q93078|H2BH_HUMAN Histone H2B.h (H2B/h) >gnl|BL_OR... 182 2e-45
gi|86305|pir||B26399 histone H2B.2 - chicken >gnl|BL_ORD_ID|7143... 182 2e-45
gi|27693390|ref|XP_227459.1| similar to histone H2b-613 [Rattus ... 182 2e-45
gi|70718|pir||HSXLB2 histone H2B.2 - African clawed frog 181 2e-45
gi|122034|sp|P06900|H2B2_XENLA Histone H2B.2 >gnl|BL_ORD_ID|6537... 181 2e-45
gi|422604|pir||S33221 histone H2B.B - African clawed frog >gnl|B... 181 2e-45
gi|4033694|sp|P30757|H2B_SIPNU Histone H2B >gnl|BL_ORD_ID|686316... 181 2e-45
gi|42542679|gb|AAH66243.1| HIST1H2BA protein [Homo sapiens] 181 3e-45
gi|42542572|gb|AAH66241.1| HIST1H2BA protein [Homo sapiens] 181 3e-45
gi|24586679|ref|NP_733759.1| testis-specific histone H2B; H2B hi... 181 3e-45
gi|47191279|emb|CAF91303.1| unnamed protein product [Tetraodon n... 181 4e-45
gi|47225211|emb|CAF98838.1| unnamed protein product [Tetraodon n... 181 4e-45
gi|28316754|ref|NP_783597.1| histone 2, H2bb [Mus musculus] >gnl... 181 4e-45
gi|28316750|ref|NP_783594.1| histone 1, H2ba [Mus musculus] >gnl... 181 4e-45
gi|31194099|ref|XP_305997.1| ENSANGP00000012781 [Anopheles gambi... 181 4e-45
gi|47225174|emb|CAF98801.1| unnamed protein product [Tetraodon n... 181 4e-45
gi|399855|sp|Q00729|H2BT_RAT Histone H2B, testis >gnl|BL_ORD_ID|... 180 5e-45
gi|50728600|ref|XP_416197.1| PREDICTED: similar to H2B histone f... 180 7e-45
gi|64322|emb|CAA26673.1| unnamed protein product [Oncorhynchus m... 180 7e-45
gi|23304756|emb|CAD37816.1| histone H2B [Mytilus edulis] >gnl|BL... 180 7e-45
gi|86303|pir||JH0362 histone H2B.V - chicken >gnl|BL_ORD_ID|1607... 180 7e-45
gi|104696|pir||A30221 histone H2B.8 - chicken 180 7e-45
gi|11036646|ref|NP_059141.1| H2B histone family, member S [Homo ... 180 7e-45
gi|48142067|ref|XP_397298.1| similar to histone H2B [Apis mellif... 180 7e-45
gi|48116273|ref|XP_396396.1| similar to Histone H2B [Apis mellif... 180 7e-45
gi|70720|pir||HSTR2B histone H2B - rainbow trout 180 7e-45
gi|50729218|ref|XP_425460.1| PREDICTED: similar to H2B histone f... 179 9e-45
gi|24585671|ref|NP_724342.1| CG17949-PA [Drosophila melanogaster... 179 9e-45
gi|122059|sp|P19374|H2B_PLADU Histone H2B >gnl|BL_ORD_ID|1188019... 179 9e-45
gi|27530990|dbj|BAC54557.1| histone 2B [Drosophila yakuba] 179 9e-45
gi|14269422|gb|AAK58064.1| histone H2B [Rhynchosciara americana] 179 9e-45
gi|122053|sp|P17271|H2B_DROHY Histone H2B >gnl|BL_ORD_ID|70454 g... 179 9e-45
gi|122060|sp|P02282|H2B_SALTR Histone H2B 179 1e-44
gi|33114090|gb|AAP94663.1| histone H2B [Mytilus chilensis] 179 1e-44
gi|3745761|pdb|1AOI|D Chain D, X-Ray Structure Of The Nucleosome... 179 1e-44
gi|42542570|gb|AAH66240.1| Testis-specific histone H2B [Homo sap... 179 1e-44
gi|70719|pir||HSSB22 histone H2B, gonadal - brown trout 179 1e-44
gi|104697|pir||B30221 histone H2B.8 - chicken (fragment) 179 1e-44
gi|6980690|pdb|2HIO|B Chain B, Histone Octamer (Chicken), Chromo... 179 2e-44
gi|50728598|ref|XP_416196.1| PREDICTED: similar to H2B histone f... 179 2e-44
gi|122045|sp|P16890|H2BO_STRPU Late histone H2B.L4 >gnl|BL_ORD_I... 179 2e-44
gi|50729212|ref|XP_425457.1| PREDICTED: similar to H2B histone f... 179 2e-44
gi|12025524|ref|NP_072169.1| testis-specific histone 2b [Rattus ... 179 2e-44
gi|47551075|ref|NP_999717.1| histone L1 H2b [Strongylocentrotus ... 179 2e-44
gi|33114082|gb|AAP94659.1| histone H2B [Mytilus galloprovincialis] 178 2e-44
gi|41152402|ref|NP_956411.1| Unknown (protein for MGC:73093); wu... 178 2e-44
gi|47198055|emb|CAF88462.1| unnamed protein product [Tetraodon n... 178 2e-44
gi|103049|pir||S21939 histone H2B - fruit fly (Drosophila hydei)... 178 2e-44
gi|38564153|dbj|BAD02422.1| histone 2B [Drosophila yakuba] 178 2e-44
gi|47223817|emb|CAF98587.1| unnamed protein product [Tetraodon n... 178 3e-44
gi|50771389|ref|XP_427116.1| PREDICTED: similar to histone H2B.8... 178 3e-44
gi|50768739|ref|XP_427013.1| PREDICTED: similar to histone H2B.8... 178 3e-44
gi|122044|sp|P16889|H2BN_STRPU Late histone H2B.L3 178 3e-44
gi|122062|sp|P27326|H2B_URECA Histone H2B >gnl|BL_ORD_ID|947279 ... 178 3e-44
gi|161370|gb|AAA30022.1| histone H2B-1 178 3e-44
gi|47204595|emb|CAF95820.1| unnamed protein product [Tetraodon n... 177 3e-44
gi|462238|sp|P35069|H2B3_TIGCA Histone H2B.3 >gnl|BL_ORD_ID|1927... 177 3e-44
gi|462237|sp|P35068|H2B1_TIGCA Histone H2B.1/H2B.2 >gnl|BL_ORD_I... 177 3e-44
gi|2564106|gb|AAC15915.1| histone H2B [Chaetopterus variopedatus] 177 3e-44
gi|38564183|dbj|BAD02446.1| histone 2B [Drosophila sechellia] 177 4e-44
gi|47115555|sp|Q7M4G7|H2B_ASTPE Histone H2B >gnl|BL_ORD_ID|13526... 177 6e-44
gi|122047|sp|P02286|H2B_ASTRU Histone H2B, gonadal >gnl|BL_ORD_I... 177 6e-44
gi|122057|sp|P02285|H2B_MARGL Histone H2B, sperm >gnl|BL_ORD_ID|... 177 6e-44
gi|63450|emb|CAA28745.1| unnamed protein product [Gallus gallus] 177 6e-44
gi|33114086|gb|AAP94661.1| histone H2B [Mytilus edulis] 176 8e-44
gi|122038|sp|P07794|H2B3_PSAMI Late histone H2B.2.1 >gnl|BL_ORD_... 176 8e-44
gi|63454|emb|CAA28747.1| unnamed protein product [Gallus gallus] 176 8e-44
gi|122049|sp|P14001|H2B_CAIMO Histone H2B >gnl|BL_ORD_ID|632944 ... 176 8e-44
gi|50540518|ref|NP_001002724.1| zgc:92591 [Danio rerio] >gnl|BL_... 176 1e-43
gi|1070595|pir||HSHUB1 histone H2B.1 - human >gnl|BL_ORD_ID|1458... 175 2e-43
gi|33114084|gb|AAP94660.1| histone H2B [Mytilus californianus] 175 2e-43
gi|12025526|ref|NP_072173.1| histone 2b [Rattus norvegicus] >gnl... 174 3e-43
gi|477676|pir||B45945 histone H2B - rat 174 3e-43
gi|47197159|emb|CAF88506.1| unnamed protein product [Tetraodon n... 174 3e-43
gi|47551079|ref|NP_999719.1| histone L3 H2b [Strongylocentrotus ... 174 3e-43
gi|1346252|sp|P48557|H2B_HOLTU Histone H2B >gnl|BL_ORD_ID|145715... 174 4e-43
gi|6686553|emb|CAB64683.1| putative H2B histone [Asellus aquaticus] 174 4e-43
gi|1870698|gb|AAB48832.1| cleavage stage histone H2B [Psammechin... 173 6e-43
gi|122042|sp|P02289|H2BE_STRPU Histone H2B, embryonic 172 1e-42
gi|122040|sp|P07795|H2B4_PSAMI Late histone H2B.2.2 >gnl|BL_ORD_... 172 1e-42
gi|70722|pir||HSUR6M histone H2B.2, embryonic - sea urchin (Psam... 172 1e-42
gi|223806|prf||0912260A histone H2B 172 1e-42
gi|70723|pir||HSUR2S histone H2B, embryonic - sea urchin (Strong... 172 1e-42
gi|122030|sp|P02288|H2B2_PSAMI Histone H2B.2, embryonic >gnl|BL_... 172 1e-42
gi|70721|pir||HSUR2M histone H2B.1, embryonic - sea urchin (Psam... 171 2e-42
gi|122018|sp|P02287|H2B1_PSAMI Histone H2B.1, embryonic >gnl|BL_... 171 2e-42
gi|17562020|ref|NP_505201.1| predicted CDS, histone (his-39) [Ca... 171 4e-42
gi|49035105|gb|AAC48034.2| Histone protein 39 [Caenorhabditis el... 171 4e-42
gi|31195811|ref|XP_306853.1| ENSANGP00000000106 [Anopheles gambi... 170 5e-42
gi|10020|emb|CAA24374.1| unnamed protein product [Psammechinus m... 170 5e-42
gi|50794704|ref|XP_423715.1| PREDICTED: similar to histone H2B -... 170 5e-42
gi|462239|sp|P35067|H2B_ACRFO Histone H2B >gnl|BL_ORD_ID|999751 ... 169 2e-41
gi|47204597|emb|CAF95822.1| unnamed protein product [Tetraodon n... 168 2e-41
gi|122017|sp|P02290|H2B1_PARAN Histone H2B.1, sperm >gnl|BL_ORD_... 167 5e-41
gi|63440|emb|CAA30590.1| unnamed protein product [Gallus gallus] 167 5e-41
gi|50285875|ref|XP_445366.1| unnamed protein product [Candida gl... 167 5e-41
gi|50292563|ref|XP_448714.1| unnamed protein product [Candida gl... 167 5e-41
gi|47551059|ref|NP_999706.1| histone H2B-1, sperm specific [Stro... 167 6e-41
gi|6320430|ref|NP_010510.1| Histone H2B (HTB1 and HTB2 code for ... 167 6e-41
gi|32421535|ref|XP_331211.1| hypothetical protein [Neurospora cr... 166 8e-41
gi|46140223|ref|XP_391802.1| H2B_NEUCR Histone H2B [Gibberella z... 166 1e-40
gi|15988135|pdb|1ID3|D Chain D, Crystal Structure Of The Yeast N... 165 2e-40
gi|2833334|sp|Q27442|H2B_ANOGA Histone H2B >gnl|BL_ORD_ID|136329... 165 2e-40
gi|6319471|ref|NP_009553.1| Histone H2B (HTB1 and HTB2 code for ... 165 2e-40
gi|122037|sp|P02292|H2B3_PARAN Histone H2B.3, sperm >gnl|BL_ORD_... 165 2e-40
gi|38105570|gb|EAA51983.1| hypothetical protein MG03578.4 [Magna... 165 2e-40
gi|161366|gb|AAA30020.1| histone H2B-1 165 2e-40
gi|27802991|emb|CAD60694.1| unnamed protein product [Podospora a... 165 2e-40
gi|122029|sp|P02291|H2B2_PARAN Histone H2B.2, sperm >gnl|BL_ORD_... 164 3e-40
gi|86313|pir||C26399 probable histone H2B - chicken (fragment) >... 164 4e-40
gi|46435164|gb|EAK94552.1| hypothetical protein CaO19.1052 [Cand... 164 5e-40
gi|27531291|dbj|BAC54259.1| histone H2B [Rosellinia necatrix] 164 5e-40
gi|32140475|gb|AAP69672.1| histone H2B [Ajellomyces capsulatus] 163 7e-40
gi|47551067|ref|NP_999710.1| histone H2B (partial) (3AA) [Strong... 163 7e-40
gi|46434099|gb|EAK93518.1| hypothetical protein CaO19.14187 [Can... 163 7e-40
gi|283352|pir||PN0142 histone H2B - Neurospora crassa (fragment)... 163 7e-40
gi|49092290|ref|XP_407606.1| H2B_EMENI Histone H2B [Aspergillus ... 163 9e-40
gi|461149|gb|AAA30021.1| histone H2B-2 162 1e-39
gi|38564173|dbj|BAD02438.1| histone 2B [Drosophila sechellia] 162 1e-39
gi|50421317|ref|XP_459208.1| unnamed protein product [Debaryomyc... 162 2e-39
gi|50425125|ref|XP_461154.1| unnamed protein product [Debaryomyc... 162 2e-39
gi|729673|sp|P06146|H2B2_LYTPI Histone H2B.2, sperm >gnl|BL_ORD_... 161 3e-39
gi|45190605|ref|NP_984859.1| AEL002Wp [Eremothecium gossypii] >g... 161 3e-39
gi|50309447|ref|XP_454731.1| unnamed protein product [Kluyveromy... 161 3e-39
gi|45201279|ref|NP_986849.1| AGR183Cp [Eremothecium gossypii] >g... 161 3e-39
gi|50311309|ref|XP_455679.1| unnamed protein product [Kluyveromy... 161 3e-39
gi|49069662|ref|XP_399120.1| H2B_AGABI Histone H2B [Ustilago may... 160 6e-39
gi|173405|gb|AAA35312.1| histone H2B-alpha 160 6e-39
gi|50259669|gb|EAL22339.1| hypothetical protein CNBB5140 [Crypto... 159 1e-38
gi|47551083|ref|NP_999721.1| histone H2b-2 [Strongylocentrotus p... 159 1e-38
gi|19075681|ref|NP_588181.1| histone h2b-alpha [Schizosaccharomy... 159 1e-38
gi|4139868|pdb|1HIO|B Chain B, Histone Octamer (Chicken), Chromo... 159 1e-38
gi|2495140|sp|P78567|H2B_AGABI Histone H2B >gnl|BL_ORD_ID|13674 ... 159 2e-38
gi|31230284|ref|XP_318364.1| ENSANGP00000002712 [Anopheles gambi... 158 2e-38
gi|32363171|sp|P82887|H2B_OLILU Histone H2B 158 3e-38
gi|122039|sp|P16867|H2B3_VOLCA Histone H2B-III >gnl|BL_ORD_ID|10... 157 5e-38
gi|122041|sp|P16868|H2B4_VOLCA Histone H2B-IV >gnl|BL_ORD_ID|891... 157 5e-38
gi|20138112|sp|O97484|H2B_EUPCR Histone H2B >gnl|BL_ORD_ID|76531... 156 8e-38
gi|41194233|ref|XP_373001.1| similar to Histone H2B.n (H2B/n) (H... 156 1e-37
gi|1708103|sp|P50565|H2B1_CHLRE Histone H2B-I >gnl|BL_ORD_ID|168... 155 1e-37
gi|1708106|sp|P54347|H2B4_CHLRE Histone H2B-IV >gnl|BL_ORD_ID|75... 155 1e-37
gi|1708105|sp|P54346|H2B3_CHLRE Histone H2B-III >gnl|BL_ORD_ID|7... 155 1e-37
gi|1708104|sp|P54345|H2B2_CHLRE Histone H2B-II >gnl|BL_ORD_ID|43... 155 2e-37
gi|1346251|sp|P49120|H2B4_MAIZE Histone H2B.4 >gnl|BL_ORD_ID|582... 155 2e-37
gi|34895904|ref|NP_909296.1| putative histone H2B [Oryza sativa ... 154 3e-37
gi|1708107|sp|P54348|H2B5_MAIZE Histone H2B >gnl|BL_ORD_ID|10858... 154 3e-37
gi|34908130|ref|NP_915412.1| putative histone H2B [Oryza sativa ... 154 4e-37
gi|399853|sp|P30755|H2B1_MAIZE Histone H2B.1 >gnl|BL_ORD_ID|1200... 154 5e-37
gi|7439754|pir||T06390 histone H2B-3 - tomato (fragment) >gnl|BL... 154 5e-37
gi|34895908|ref|NP_909298.1| putative histone H2B [Oryza sativa ... 154 5e-37
gi|7635498|emb|CAB88668.1| histone H2B [Cicer arietinum] 153 7e-37
gi|122022|sp|P27807|H2B1_WHEAT Histone H2B >gnl|BL_ORD_ID|111919... 153 7e-37
gi|399854|sp|P30756|H2B2_MAIZE Histone H2B.2 >gnl|BL_ORD_ID|5200... 153 7e-37
gi|3913804|sp|Q43261|H2B3_MAIZE Histone H2B.3 >gnl|BL_ORD_ID|111... 153 7e-37
gi|7387726|sp|O22582|H2B_GOSHI Histone H2B >gnl|BL_ORD_ID|357612... 153 7e-37
gi|1362183|pir||S56684 histone H2B-6 - wheat >gnl|BL_ORD_ID|8513... 153 9e-37
gi|42408493|dbj|BAD09673.1| putative Histone H2B.2 [Oryza sativa... 153 9e-37
gi|46229396|gb|EAK90214.1| histone H2B, transcripts identified b... 153 9e-37
gi|47900320|gb|AAT39167.1| putative histone H2B [Oryza sativa (j... 152 1e-36
gi|32401027|gb|AAP80719.1| histone H2B protein [Griffithsia japo... 152 1e-36
gi|7387727|sp|O49118|H2B_CAPAN Histone H2B (CaH2B) >gnl|BL_ORD_I... 152 1e-36
gi|7387729|sp|P93354|H2B_TOBAC Histone H2B >gnl|BL_ORD_ID|396184... 152 1e-36
gi|50554033|ref|XP_504425.1| hypothetical protein [Yarrowia lipo... 152 2e-36
gi|50080248|gb|AAT69583.1| putative histone H2B [Oryza sativa (j... 152 2e-36
gi|629864|pir||S48838 histone H2B - garden asparagus >gnl|BL_ORD... 152 2e-36
gi|15226943|ref|NP_180440.1| histone H2B, putative [Arabidopsis ... 152 2e-36
gi|34895896|ref|NP_909292.1| putative histone H2B [Oryza sativa ... 152 2e-36
gi|1346250|sp|P48989|H2B1_CANAL Histone H2B.1 152 2e-36
gi|1617013|emb|CAA69025.1| histone H2B like protein [Arabidopsis... 152 2e-36
gi|15237148|ref|NP_197679.1| histone H2B, putative [Arabidopsis ... 152 2e-36
gi|30024116|emb|CAC84679.1| putative histone H4 [Pinus pinaster] 152 2e-36
gi|21617908|gb|AAM66958.1| histone H2B [Arabidopsis thaliana] 152 2e-36
gi|15223016|ref|NP_172258.1| histone H2B, putative [Arabidopsis ... 152 2e-36
gi|15238563|ref|NP_200799.1| histone H2B [Arabidopsis thaliana] ... 151 3e-36
gi|1362184|pir||S56685 histone H2B-8 - wheat >gnl|BL_ORD_ID|1711... 151 3e-36
gi|15231304|ref|NP_190184.1| histone H2B [Arabidopsis thaliana] ... 151 3e-36
gi|15231313|ref|NP_190189.1| histone H2B, putative [Arabidopsis ... 151 3e-36
gi|15529616|gb|AAL01371.1| histone H2B variant 1 [Toxoplasma gon... 150 4e-36
gi|21554180|gb|AAM63259.1| histone H2B-like protein [Arabidopsis... 150 6e-36
gi|15241858|ref|NP_195877.1| histone H2B, putative [Arabidopsis ... 150 6e-36
gi|34895888|ref|NP_909288.1| putative histone H2B [Oryza sativa ... 150 8e-36
gi|34895838|ref|NP_909263.1| putative histone H2B [Oryza sativa ... 150 8e-36
gi|34895832|ref|NP_909260.1| putative histone H2B [Oryza sativa ... 150 8e-36
gi|49659794|gb|AAT68209.1| putative histone H2B [Cynodon dactylon] 150 8e-36
gi|15231854|ref|NP_190933.1| histone H2B, putative [Arabidopsis ... 149 1e-35
gi|529959|gb|AAA20822.1| histone H2B 149 1e-35
gi|34895900|ref|NP_909294.1| putative histone H2B [Oryza sativa ... 149 1e-35
gi|15232689|ref|NP_187559.1| histone H2B, putative [Arabidopsis ... 149 1e-35
gi|122033|sp|P05621|H2B2_WHEAT Histone H2B.2 >gnl|BL_ORD_ID|1049... 149 1e-35
gi|1362186|pir||S56687 histone H2B153 - wheat >gnl|BL_ORD_ID|171... 149 1e-35
gi|48099573|ref|XP_394912.1| similar to Histone H2B [Apis mellif... 149 2e-35
gi|15224292|ref|NP_181283.1| histone H2B, putative [Arabidopsis ... 148 2e-35
gi|7439753|pir||T06389 histone H2B-2 - tomato (fragment) >gnl|BL... 148 3e-35
gi|2935450|gb|AAC05126.1| histone H2B [Malus x domestica] 148 3e-35
gi|23508258|ref|NP_700927.1| histone H2B [Plasmodium falciparum ... 147 5e-35
gi|23612515|ref|NP_704076.1| histone h2b, putative [Plasmodium f... 147 5e-35
gi|23490271|gb|EAA22088.1| histone H2B variant 1 [Plasmodium yoe... 147 5e-35
gi|4138413|emb|CAA76839.1| histone 2B [Plasmodium vivax] 147 5e-35
gi|7439756|pir||T06393 histone H2B - tomato >gnl|BL_ORD_ID|19507... 147 6e-35
gi|247309|gb|AAB21816.1| histone H2B [Chlamydomonas reinhardtii,... 146 1e-34
gi|47202651|emb|CAF87569.1| unnamed protein product [Tetraodon n... 134 1e-34
gi|556610|gb|AAC46612.1| histone H2B 145 2e-34
gi|47115547|sp|Q7M400|H2B_TETPY Histone H2B >gnl|BL_ORD_ID|14582... 145 2e-34
gi|122032|sp|P08994|H2B2_TETTH Histone H2B.2 (H2B-2) >gnl|BL_ORD... 145 2e-34
gi|122021|sp|P08993|H2B1_TETTH Histone H2B.1 (H2B-1) >gnl|BL_ORD... 145 2e-34
gi|223398|prf||0803211A histone H2B 145 2e-34
gi|161316|gb|AAA30001.1| histone H2b 144 3e-34
gi|223272|prf||0702236A histone H2B 141 4e-33
gi|46227276|gb|EAK88226.1| histone H2B [Cryptosporidium parvum] 139 2e-32
gi|47199836|emb|CAF88842.1| unnamed protein product [Tetraodon n... 134 2e-32
gi|1362185|pir||S56686 histone H2B123 - wheat >gnl|BL_ORD_ID|152... 135 2e-31
gi|18129292|emb|CAC83359.1| histone H2B protein [Pinus pinaster] 132 1e-30
gi|4376099|emb|CAA64986.1| Histone H2b homologue [Allium cepa] 132 2e-30
gi|13812289|ref|NP_113407.1| histon H2B [Guillardia theta] >gnl|... 131 3e-30
gi|1850595|gb|AAB48092.1| histone H2B [Drosophila virilis] >gnl|... 130 6e-30
gi|47225161|emb|CAF98788.1| unnamed protein product [Tetraodon n... 125 2e-28
gi|49257898|gb|AAH73925.1| Unknown (protein for MGC:90432) [Homo... 124 6e-28
gi|15223150|ref|NP_172295.1| histone H2B family protein [Arabido... 123 1e-27
gi|50261574|gb|AAT72343.1| H2B/t variant [Homo sapiens] 116 1e-27
gi|49659929|gb|AAT68256.1| histone H2B/s [Homo sapiens] 116 1e-27
gi|26345578|dbj|BAC36440.1| unnamed protein product [Mus musculus] 114 4e-25
gi|2696388|dbj|BAA23954.1| Histone H2b [Bombyx mori] 114 6e-25
gi|13898830|gb|AAK48889.1| histone H2B-1 [Lolium perenne] 112 1e-24
gi|122061|sp|P27795|H2B_TRYCR Histone H2B >gnl|BL_ORD_ID|1202999... 105 2e-22
gi|12838850|dbj|BAB24353.1| unnamed protein product [Mus musculus] 105 2e-22
gi|6006737|gb|AAF00591.1| histone H2B [Giardia intestinalis] >gn... 105 3e-22
gi|161372|gb|AAA30023.1| late histone H2B-2 102 1e-21
gi|46911573|emb|CAG27626.1| putative histone H2B [Populus eurame... 100 9e-21
gi|17426467|emb|CAD13498.1| bA370B6.1 (similar to histone H2B) [... 100 1e-20
gi|37546233|ref|XP_210048.2| similar to histone H2B-related prot... 100 1e-20
gi|37546259|ref|XP_293320.3| similar to bA370B6.1 (similar to hi... 100 1e-20
gi|2143266|emb|CAA73826.1| histone H2B [Leishmania infantum] 99 2e-20
gi|729675|sp|P40284|H2B_ENTIV Histone H2B >gnl|BL_ORD_ID|1755453... 99 2e-20
gi|13384083|gb|AAK21263.1| histone H2B [Leishmania major] 98 3e-20
gi|6165652|gb|AAF04631.1| histone H2B variant 1 [Leishmania major] 98 3e-20
gi|6165654|gb|AAF04632.1| histone H2B variant 2 [Leishmania major] 98 4e-20
gi|122056|sp|P27893|H2B_LEIEN Histone H2B >gnl|BL_ORD_ID|493209 ... 97 6e-20
gi|45429973|ref|NP_991343.1| histone H2B variant PT15 [Bos tauru... 97 6e-20
gi|47225212|emb|CAF98839.1| unnamed protein product [Tetraodon n... 90 2e-19
gi|41210299|ref|XP_373359.1| similar to histone H2B-related prot... 96 2e-19
gi|27902593|gb|AAO24603.1| histone H2B variant [Trypanosoma bruc... 95 4e-19
gi|2350887|dbj|BAA21977.1| histone H2B [Entamoeba histolytica] 95 4e-19
gi|30923862|gb|EAA46339.1| CG40461-PA [Drosophila melanogaster] 94 5e-19
gi|1881592|gb|AAB49447.1| histone H2b [Drosophila virilis] 94 6e-19
gi|18596433|ref|XP_088735.1| similar to histone H2B-related prot... 94 8e-19
gi|3819712|emb|CAA09733.1| histone H2B [Trypanosoma brucei] 94 8e-19
gi|17512299|gb|AAH19122.1| Similar to H2B histone family, member... 93 1e-18
gi|15680004|gb|AAH14312.1| HIST1H2BJ protein [Homo sapiens] 93 1e-18
gi|30908970|gb|AAP37489.1| histone H2B-related protein [Homo sap... 92 3e-18
gi|47223651|emb|CAF99260.1| unnamed protein product [Tetraodon n... 91 5e-18
gi|8096190|dbj|BAA96095.1| gH2B [Lilium longiflorum] 88 4e-17
gi|47190720|emb|CAF94086.1| unnamed protein product [Tetraodon n... 88 4e-17
gi|34878605|ref|XP_344528.1| similar to Histone H2B 291B [Rattus... 88 4e-17
gi|20909358|ref|XP_127485.1| RIKEN cDNA 1700024P04 [Mus musculus... 86 1e-16
gi|86301|pir||S19237 histone H2B (clone pCH22.0B) - chicken (fra... 84 9e-16
gi|31210963|ref|XP_314448.1| ENSANGP00000016043 [Anopheles gambi... 82 3e-15
gi|13898834|gb|AAK48891.1| histone H2B-3 [Lolium perenne] 76 2e-13
gi|13898838|gb|AAK48893.1| histone H2B-5 [Lolium perenne] 75 2e-13
gi|13898832|gb|AAK48890.1| histone H2B-2 [Lolium perenne] 75 2e-13
gi|38086770|ref|XP_142163.2| similar to Glycogen synthase kinase... 75 3e-13
gi|50728596|ref|XP_416195.1| PREDICTED: similar to histone 2, H2... 70 1e-11
gi|47220351|emb|CAF98450.1| unnamed protein product [Tetraodon n... 57 2e-11
gi|1199969|emb|CAA64987.1| Histone H2b homologue [Allium cepa] 66 1e-10
gi|17505204|ref|NP_075911.1| histone 1, H2bc; H2B histone family... 66 2e-10
gi|10229|emb|CAA24981.1| unnamed protein product [Strongylocentr... 60 8e-09
gi|70740|pir||HSAK22 histone H2B - Nile crocodile (tentative seq... 60 1e-08
gi|122052|sp|P02280|H2B_CRONI Histone H2B 60 1e-08
gi|47198729|emb|CAF88835.1| unnamed protein product [Tetraodon n... 52 3e-06
gi|47192103|emb|CAF87173.1| unnamed protein product [Tetraodon n... 52 3e-06
gi|47193370|emb|CAF93019.1| unnamed protein product [Tetraodon n... 52 4e-06
gi|42733694|gb|AAS38634.1| similar to Plasmodium falciparum. Hyp... 46 2e-04
gi|27372639|gb|AAO06218.1| histone protein Hist1h1e [Mus musculus] 45 4e-04
gi|41202697|ref|XP_372488.1| similar to histone 1, H2bc; H2B his... 39 5e-04
gi|18265393|gb|AAL67160.1| histone H2B [Trichinella spiralis] 44 8e-04
gi|47215237|emb|CAG01129.1| unnamed protein product [Tetraodon n... 41 0.005
gi|27368169|gb|AAN87205.1| histone H2B [Drosophila rufa] >gnl|BL... 37 0.071
gi|27368216|gb|AAN87235.1| histone H2B [Drosophila prolongata] >... 37 0.071
gi|27368219|gb|AAN87237.1| histone H2B [Drosophila trilutea] 36 0.21
gi|38101360|gb|EAA48336.1| hypothetical protein MG10595.4 [Magna... 35 0.35
gi|47221339|emb|CAF97257.1| unnamed protein product [Tetraodon n... 34 0.60
gi|46116868|ref|XP_384452.1| hypothetical protein FG04276.1 [Gib... 33 1.0
gi|27368242|gb|AAN87251.1| histone H2B [Drosophila takahashii] 33 1.3
gi|47223584|emb|CAF99193.1| unnamed protein product [Tetraodon n... 32 2.3
gi|36958829|gb|AAQ87254.1| Coenzyme PQQ synthesis protein C [Rhi... 32 2.3
gi|17558248|ref|NP_507774.1| predicted CDS, putative protein fam... 32 2.3
gi|25404537|pir||A96676 hypothetical protein T23K8.11 [imported]... 32 2.3
gi|49402267|ref|NP_849221.2| expressed sequence AW539457 [Mus mu... 32 3.9
gi|19705529|ref|NP_599230.1| Cca3 protein [Rattus norvegicus] >g... 32 3.9
gi|21735594|ref|NP_659005.1| programmed cell death 2 isoform 2; ... 32 3.9
gi|2135977|pir||I52969 programmed cell death 2 - human >gnl|BL_O... 32 3.9
gi|21735592|ref|NP_002589.2| programmed cell death 2 isoform 1; ... 32 3.9
gi|31652302|emb|CAD92541.1| dJ191N21.1.2 (Programmed cell death ... 32 3.9
gi|6018683|emb|CAB57881.1| DNA-directed DNA polymerase [Schizosa... 31 5.1
gi|19115098|ref|NP_594186.1| dna polymerase alpha [Schizosacchar... 31 5.1
gi|29245959|gb|EAA37574.1| GLP_503_7809_8156 [Giardia lamblia AT... 31 5.1
gi|42408276|dbj|BAD09431.1| hypothetical protein [Oryza sativa (... 31 5.1
gi|23484113|gb|EAA19556.1| synthetic antigen of P.falciparum [Pl... 31 5.1
gi|23478027|gb|EAA15225.1| hypothetical protein [Plasmodium yoel... 31 5.1
gi|50758825|ref|XP_417434.1| PREDICTED: similar to decoy recepto... 31 6.7
gi|39937209|ref|NP_949485.1| Beta-lactamase-like [Rhodopseudomon... 30 8.7
gi|50730440|ref|XP_416905.1| PREDICTED: similar to replication-d... 30 8.7
gi|30016907|gb|AAP03889.1| decoy receptor 3 [Gallus gallus] 30 8.7
gi|16079599|ref|NP_390423.1| yqeT [Bacillus subtilis subsp. subt... 30 8.7
gi|23010332|ref|ZP_00051057.1| COG0242: N-formylmethionyl-tRNA d... 30 8.7
>gi|17559286|ref|NP_505278.1| predicted CDS, histone (his-52)
[Caenorhabditis elegans]
gi|17559300|ref|NP_505279.1| predicted CDS, histone (his-54)
[Caenorhabditis elegans]
gi|15145311|gb|AAK84507.1| Hypothetical protein F07B7.11
[Caenorhabditis elegans]
gi|15145317|gb|AAK84513.1| Hypothetical protein F07B7.4
[Caenorhabditis elegans]
Length = 141
Score = 197 bits (500), Expect = 5e-50
Identities = 101/101 (100%), Positives = 101/101 (100%)
Frame = +1
Query: 64 DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN 243
DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN
Sbjct: 41 DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN 100
Query: 244 KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 366
KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK
Sbjct: 101 KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 141
>gi|17561988|ref|NP_507031.1| histone (his-4) [Caenorhabditis
elegans]
gi|7507600|pir||T24788 hypothetical protein T10C6.11 -
Caenorhabditis elegans
gi|3879733|emb|CAB07654.1| C. elegans HIS-4 protein (corresponding
sequence T10C6.11) [Caenorhabditis elegans]
Length = 141
Score = 197 bits (500), Expect = 5e-50
Identities = 101/101 (100%), Positives = 101/101 (100%)
Frame = +1
Query: 64 DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN 243
DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN
Sbjct: 41 DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN 100
Query: 244 KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 366
KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK
Sbjct: 101 KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 141
>gi|17532989|ref|NP_496897.1| histone (his-44) [Caenorhabditis
elegans]
gi|17534749|ref|NP_496892.1| histone (13.5 kD) (his-11)
[Caenorhabditis elegans]
gi|17534757|ref|NP_496888.1| histone (13.5 kD) (his-15)
[Caenorhabditis elegans]
gi|17540174|ref|NP_501403.1| histone (his-29) [Caenorhabditis
elegans]
gi|17541092|ref|NP_501409.1| predicted CDS, histone (his-34)
[Caenorhabditis elegans]
gi|45644941|sp|P04255|H2B1_CAEEL Histone H2B 1
gi|25294267|pir||D88357 protein ZK131.5 [imported] - Caenorhabditis
elegans
gi|25294268|pir||D88753 protein his-11 [imported] - Caenorhabditis
elegans
gi|6755|emb|CAA33642.1| histone protein [Caenorhabditis elegans]
gi|2935374|gb|AAC05103.1| Histone protein 34 [Caenorhabditis
elegans]
gi|3875623|emb|CAB04061.1| Hypothetical protein F08G2.1
[Caenorhabditis elegans]
gi|3881581|emb|CAB05830.1| C. elegans HIS-15 protein (corresponding
sequence ZK131.9) [Caenorhabditis elegans]
gi|3881583|emb|CAB05832.1| C. elegans HIS-11 protein (corresponding
sequence ZK131.5) [Caenorhabditis elegans]
gi|15145338|gb|AAK84525.1| Histone protein 29 [Caenorhabditis
elegans]
Length = 122
Score = 197 bits (500), Expect = 5e-50
Identities = 101/101 (100%), Positives = 101/101 (100%)
Frame = +1
Query: 64 DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN 243
DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN
Sbjct: 22 DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN 81
Query: 244 KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 366
KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK
Sbjct: 82 KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 122
>gi|17561996|ref|NP_505197.1| histone (his-8) [Caenorhabditis
elegans]
gi|17562004|ref|NP_505295.1| histone (his-20) [Caenorhabditis
elegans]
gi|17562008|ref|NP_505294.1| histone (13.5 kD) (his-22)
[Caenorhabditis elegans]
gi|45476817|sp|Q27894|H2B2_CAEEL Histone H2B 2
gi|11383222|pir||HSKW22 histone H2B [validated] - Caenorhabditis
elegans
gi|1458310|gb|AAC48023.1| Histone protein 8 [Caenorhabditis
elegans]
gi|9755512|gb|AAF98225.1| Histone protein 20 [Caenorhabditis
elegans]
gi|9755517|gb|AAF98230.1| Histone protein 22 [Caenorhabditis
elegans]
Length = 123
Score = 197 bits (500), Expect = 5e-50
Identities = 101/101 (100%), Positives = 101/101 (100%)
Frame = +1
Query: 64 DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN 243
DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN
Sbjct: 23 DGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYN 82
Query: 244 KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 366
KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK
Sbjct: 83 KRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123