Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK637_1
(765 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|32564663|ref|NP_498960.2| general substrate transporter (57.2... 505 e-142
gi|7511251|pir||T23190 hypothetical protein ZK637.1 - Caenorhabd... 505 e-142
gi|102506|pir||S15786 glucose transport protein homolog - Caenor... 505 e-142
gi|39587141|emb|CAE57609.1| Hypothetical protein CBG00590 [Caeno... 483 e-135
gi|23603513|ref|XP_149659.2| RIKEN cDNA 1110030H18 [Mus musculus... 244 2e-63
gi|26338958|dbj|BAC33150.1| unnamed protein product [Mus musculus] 244 2e-63
gi|37590597|gb|AAH59878.1| 1110030H18Rik protein [Mus musculus] 244 2e-63
gi|19705531|ref|NP_599231.1| SV2 related protein [Rattus norvegi... 243 4e-63
gi|24308167|ref|NP_061181.1| hypothetical protein DKFZp761H039 [... 243 4e-63
gi|31198525|ref|XP_308210.1| ENSANGP00000009299 [Anopheles gambi... 233 4e-60
gi|50756496|ref|XP_415186.1| PREDICTED: similar to hypothetical ... 232 6e-60
gi|47226493|emb|CAG08509.1| unnamed protein product [Tetraodon n... 232 6e-60
gi|19922874|ref|NP_611868.1| CG4324-PA [Drosophila melanogaster]... 213 3e-54
gi|15230680|ref|NP_187911.1| transporter-related [Arabidopsis th... 176 5e-43
gi|15795137|dbj|BAB02515.1| transporter-like protein [Arabidopsi... 176 5e-43
gi|47223642|emb|CAF99251.1| unnamed protein product [Tetraodon n... 175 1e-42
gi|37718860|gb|AAR01731.1| putative sugar transporter (alternati... 162 7e-39
gi|37718861|gb|AAR01732.1| putative sugar transporter (alternati... 162 7e-39
gi|34394216|dbj|BAC84668.1| putative organic cation transporter ... 158 1e-37
gi|28893221|ref|NP_796174.1| RIKEN cDNA 9430071P14 gene [Mus mus... 149 8e-35
gi|37590471|gb|AAH58741.1| Unknown (protein for MGC:65540) [Mus ... 149 8e-35
gi|38567900|emb|CAE03655.2| OSJNBa0060N03.20 [Oryza sativa (japo... 146 5e-34
gi|45516798|ref|ZP_00168350.1| COG0477: Permeases of the major f... 139 9e-32
gi|15807933|ref|NP_285594.1| sugar transporter, putative [Deinoc... 137 2e-31
gi|48769812|ref|ZP_00274156.1| COG0477: Permeases of the major f... 128 1e-28
gi|46198628|ref|YP_004295.1| sugar transport protein [Thermus th... 123 5e-27
gi|50083512|ref|YP_045022.1| putative transport protein (MFS sup... 121 2e-26
gi|47225909|emb|CAF98389.1| unnamed protein product [Tetraodon n... 119 5e-26
gi|15889534|ref|NP_355215.1| AGR_C_4107p [Agrobacterium tumefaci... 118 1e-25
gi|16263243|ref|NP_436036.1| Putative transmembrane transport pr... 117 2e-25
gi|48869976|ref|ZP_00322709.1| COG0477: Permeases of the major f... 114 2e-24
gi|17989085|ref|NP_541718.1| TRANSPORTER, MFS superfamily [Bruce... 113 4e-24
gi|23500279|ref|NP_699719.1| major facilitator family transporte... 113 4e-24
gi|15644351|ref|NP_229403.1| permease, putative [Thermotoga mari... 113 5e-24
gi|50728906|ref|XP_416338.1| PREDICTED: similar to MGC68661 prot... 113 5e-24
gi|46365193|ref|ZP_00227700.1| COG0477: Permeases of the major f... 108 9e-23
gi|16077364|ref|NP_388177.1| yceI [Bacillus subtilis subsp. subt... 107 2e-22
gi|42784592|ref|NP_981839.1| major facilitator family transporte... 107 3e-22
gi|30265438|ref|NP_847815.1| major facilitator family transporte... 107 4e-22
gi|47568535|ref|ZP_00239234.1| major facilitator family transpor... 107 4e-22
gi|30023448|ref|NP_835079.1| Transporter, MFS superfamily [Bacil... 107 4e-22
gi|23465940|ref|NP_696543.1| probable sugar transporter [Bifidob... 107 4e-22
gi|38234822|ref|NP_940589.1| Putative integral membrane transpor... 106 6e-22
gi|48786181|ref|ZP_00282390.1| COG0477: Permeases of the major f... 106 6e-22
gi|28379060|ref|NP_785952.1| transport protein [Lactobacillus pl... 105 8e-22
gi|23335392|ref|ZP_00120628.1| COG0477: Permeases of the major f... 105 8e-22
gi|17548273|ref|NP_521613.1| PROBABLE METABOLITE TRANSPORT TRANS... 104 2e-21
gi|38638564|ref|NP_943150.1| benzoate transporter protein [Pseud... 104 2e-21
gi|23309001|ref|NP_602171.2| putative transmembrane transport pr... 102 7e-21
gi|41222972|emb|CAF18917.1| Permease of the major facilitator su... 102 7e-21
gi|25029370|ref|NP_739424.1| putative transport protein [Coryneb... 101 2e-20
gi|31212363|ref|XP_315166.1| ENSANGP00000020967 [Anopheles gambi... 101 2e-20
gi|32412596|ref|XP_326778.1| hypothetical protein [Neurospora cr... 101 2e-20
gi|27479151|ref|XP_043493.5| synaptic vesicle protein 2C [Homo s... 101 2e-20
gi|46313181|ref|ZP_00213772.1| COG0477: Permeases of the major f... 101 2e-20
gi|2119806|pir||I50531 transmembrane transporter - electric ray ... 101 2e-20
gi|40788343|dbj|BAA34456.2| KIAA0736 protein [Homo sapiens] 100 3e-20
gi|33438274|dbj|BAC65642.2| mKIAA0736 protein [Mus musculus] 100 3e-20
gi|22761654|dbj|BAC11645.1| unnamed protein product [Homo sapiens] 100 3e-20
gi|38111348|gb|EAA56941.1| hypothetical protein MG07296.4 [Magna... 100 3e-20
gi|11528518|ref|NP_071313.1| synaptic vesicle glycoprotein 2 a [... 100 3e-20
gi|27806795|ref|NP_776387.1| synaptic vesicle glycoprotein 2 [Bo... 100 3e-20
gi|28175250|gb|AAH45111.1| Synaptic vesicle glycoprotein 2 [Homo... 100 3e-20
gi|17105366|ref|NP_476558.1| synaptic vesicle glycoprotein 2 a [... 100 3e-20
gi|41281524|ref|NP_055664.2| synaptic vesicle glycoprotein 2 [Ho... 100 3e-20
gi|383109|prf||1902226A transporter-like protein p87 100 3e-20
gi|285432|pir||A43344 synaptic vesicle protein SV2 - rat 100 3e-20
gi|50761683|ref|XP_429151.1| PREDICTED: similar to synaptic vesi... 100 3e-20
gi|38014333|gb|AAH00776.2| SV2A protein [Homo sapiens] 100 3e-20
gi|47211700|emb|CAF90816.1| unnamed protein product [Tetraodon n... 100 4e-20
gi|13928804|ref|NP_113781.1| synaptic vesicle protein 2C [Rattus... 99 1e-19
gi|24640196|ref|NP_572345.1| CG3168-PA [Drosophila melanogaster]... 99 1e-19
gi|38075091|ref|XP_127490.2| synaptic vesicle protein 2C [Mus mu... 99 1e-19
gi|50510769|dbj|BAD32370.1| mKIAA1054 protein [Mus musculus] 99 1e-19
gi|49094316|ref|XP_408619.1| hypothetical protein AN4482.2 [Aspe... 98 2e-19
gi|23114878|ref|ZP_00100158.1| COG0477: Permeases of the major f... 98 2e-19
gi|31208145|ref|XP_313039.1| ENSANGP00000022468 [Anopheles gambi... 97 3e-19
gi|50753142|ref|XP_425081.1| PREDICTED: similar to synaptic vesi... 97 4e-19
gi|32038567|ref|ZP_00136839.1| COG0477: Permeases of the major f... 97 5e-19
gi|15600093|ref|NP_253587.1| probable MFS transporter [Pseudomon... 97 5e-19
gi|15598663|ref|NP_252157.1| probable MFS transporter [Pseudomon... 96 6e-19
gi|18313266|ref|NP_559933.1| sugar transporter, conjectural [Pyr... 96 8e-19
gi|31201705|ref|XP_309800.1| ENSANGP00000012563 [Anopheles gambi... 96 1e-18
gi|48732311|ref|ZP_00266054.1| COG0477: Permeases of the major f... 96 1e-18
gi|47214504|emb|CAG00928.1| unnamed protein product [Tetraodon n... 96 1e-18
gi|47226719|emb|CAG07878.1| unnamed protein product [Tetraodon n... 94 3e-18
gi|23112836|ref|ZP_00098269.1| COG0477: Permeases of the major f... 93 7e-18
gi|23113353|ref|ZP_00098736.1| COG0477: Permeases of the major f... 92 9e-18
gi|27261824|ref|NP_705807.2| synaptic vesicle glycoprotein 2 b [... 92 2e-17
gi|50257525|gb|EAL20230.1| hypothetical protein CNBF0420 [Crypto... 92 2e-17
gi|37142953|gb|AAQ88395.1| SV2-like protein 2 [Ctenocephalides f... 91 2e-17
gi|49072452|ref|XP_400515.1| hypothetical protein UM02900.1 [Ust... 91 2e-17
gi|24641384|ref|NP_572745.1| CG15221-PA [Drosophila melanogaster... 91 2e-17
gi|50084962|ref|YP_046472.1| putative benzoate transport protein... 91 2e-17
gi|28972375|dbj|BAC65641.1| mKIAA0735 protein [Mus musculus] 91 3e-17
gi|49137444|ref|XP_413426.1| hypothetical protein AN9289.2 [Aspe... 91 3e-17
gi|45516167|ref|ZP_00167720.1| COG0477: Permeases of the major f... 90 5e-17
gi|7542440|gb|AAF63452.1| benzoate transport protein [Pseudomona... 90 5e-17
gi|31204139|ref|XP_311018.1| ENSANGP00000019864 [Anopheles gambi... 90 6e-17
gi|27380607|ref|NP_772136.1| hypothetical metabolite transport p... 90 6e-17
gi|48138648|ref|XP_393415.1| similar to ENSANGP00000012563 [Apis... 90 6e-17
gi|48786004|ref|ZP_00282213.1| COG0477: Permeases of the major f... 90 6e-17
gi|47228447|emb|CAG05267.1| unnamed protein product [Tetraodon n... 89 8e-17
gi|31204751|ref|XP_311324.1| ENSANGP00000017489 [Anopheles gambi... 89 8e-17
gi|17989369|ref|NP_542002.1| CIS,CIS-MUCONATE TRANSPORT PROTEIN ... 89 1e-16
gi|26989884|ref|NP_745309.1| benzoate MFS transporter BenK [Pseu... 88 2e-16
gi|7662270|ref|NP_055663.1| synaptic vesicle protein 2B homolog ... 88 2e-16
gi|48146289|emb|CAG33367.1| SV2B [Homo sapiens] 88 2e-16
gi|17545812|ref|NP_519214.1| PUTATIVE 4-HYDROXYBENZOATE TRANSPOR... 88 2e-16
gi|47229365|emb|CAF99353.1| unnamed protein product [Tetraodon n... 88 2e-16
gi|40788342|dbj|BAA34455.2| KIAA0735 protein [Homo sapiens] 88 2e-16
gi|48115877|ref|XP_396392.1| similar to transmembrane transporte... 88 2e-16
gi|34496448|ref|NP_900663.1| 4-hydroxybenzoate transporter [Chro... 88 2e-16
gi|17105360|ref|NP_476555.1| synaptic vesicle glycoprotein 2 b [... 88 2e-16
gi|17298110|dbj|BAB78523.1| 2,4-D transporter [Bradyrhizobium sp... 88 2e-16
gi|23106470|ref|ZP_00092924.1| COG0477: Permeases of the major f... 88 2e-16
gi|49067062|ref|XP_397821.1| hypothetical protein UM00206.1 [Ust... 87 3e-16
gi|23499978|ref|NP_699418.1| cis,cis-muconate transport protein ... 87 3e-16
gi|32037452|ref|ZP_00135724.1| COG0477: Permeases of the major f... 87 3e-16
gi|15597668|ref|NP_251162.1| probable MFS transporter [Pseudomon... 87 3e-16
gi|15889790|ref|NP_355471.1| AGR_C_4589p [Agrobacterium tumefaci... 87 3e-16
gi|17936406|ref|NP_533196.1| MFS permease [Agrobacterium tumefac... 87 3e-16
gi|31208149|ref|XP_313041.1| ENSANGP00000011271 [Anopheles gambi... 87 4e-16
gi|48866123|ref|ZP_00319980.1| COG0477: Permeases of the major f... 87 4e-16
gi|45368568|ref|NP_990896.1| TfdK [Achromobacter denitrificans] ... 86 1e-15
gi|6521708|dbj|BAA88072.1| putative transport protein [Variovora... 86 1e-15
gi|15026871|gb|AAK81680.1| putative transport protein [Burkholde... 86 1e-15
gi|37527021|ref|NP_930365.1| hypothetical protein [Photorhabdus ... 86 1e-15
gi|46317615|ref|ZP_00218193.1| COG0477: Permeases of the major f... 86 1e-15
gi|45514602|ref|ZP_00166159.1| COG0477: Permeases of the major f... 86 1e-15
gi|46321213|ref|ZP_00221592.1| COG0477: Permeases of the major f... 85 1e-15
gi|21723492|gb|AAM76773.1| putative transport protein [Delftia a... 85 2e-15
gi|15832285|ref|NP_311058.1| putative transport protein [Escheri... 85 2e-15
gi|48783167|ref|ZP_00279629.1| COG0477: Permeases of the major f... 84 2e-15
gi|50084863|ref|YP_046373.1| 4-hydroxybenzoate transporter (MFS ... 84 3e-15
gi|6093654|sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter >g... 84 3e-15
gi|50421933|ref|XP_459525.1| unnamed protein product [Debaryomyc... 84 3e-15
gi|1095059|prf||2107260F ORF 84 3e-15
gi|46317925|ref|ZP_00218503.1| COG0477: Permeases of the major f... 84 4e-15
gi|46315729|ref|ZP_00216310.1| COG0477: Permeases of the major f... 84 4e-15
gi|23104011|ref|ZP_00090481.1| COG0477: Permeases of the major f... 83 6e-15
gi|46312755|ref|ZP_00213349.1| COG0477: Permeases of the major f... 83 6e-15
gi|48780855|ref|ZP_00277520.1| COG0477: Permeases of the major f... 83 6e-15
gi|46131705|ref|ZP_00170071.2| COG0477: Permeases of the major f... 83 7e-15
gi|23102660|ref|ZP_00089162.1| COG0477: Permeases of the major f... 83 7e-15
gi|16761121|ref|NP_456738.1| putative n-hydroxybenzoate transpor... 83 7e-15
gi|48781214|ref|ZP_00277854.1| COG0477: Permeases of the major f... 82 9e-15
gi|50084838|ref|YP_046348.1| cis,cis-muconate transport protein ... 82 9e-15
gi|46316204|ref|ZP_00216784.1| COG0477: Permeases of the major f... 82 2e-14
gi|38107345|gb|EAA53531.1| hypothetical protein MG07808.4 [Magna... 81 2e-14
gi|16081684|ref|NP_394055.1| sugar transport protein related pro... 81 2e-14
gi|45514611|ref|ZP_00166168.1| COG0477: Permeases of the major f... 81 2e-14
gi|46131614|ref|ZP_00169939.2| COG0477: Permeases of the major f... 81 3e-14
gi|46319497|ref|ZP_00219902.1| COG0477: Permeases of the major f... 81 3e-14
gi|15802695|ref|NP_288722.1| putative transporter [Escherichia c... 81 3e-14
gi|48787200|ref|ZP_00283282.1| COG0477: Permeases of the major f... 81 3e-14
gi|16081136|ref|NP_391964.1| yyaJ [Bacillus subtilis subsp. subt... 81 3e-14
gi|438464|gb|AAA64342.1| Hydrophobic; homology with membrane tra... 81 3e-14
gi|46317099|ref|ZP_00217677.1| COG0477: Permeases of the major f... 80 4e-14
gi|38101602|gb|EAA48543.1| hypothetical protein MG00201.4 [Magna... 80 4e-14
gi|26990446|ref|NP_745871.1| major facilitator family transporte... 80 5e-14
gi|23103754|ref|ZP_00090230.1| COG0477: Permeases of the major f... 80 5e-14
gi|46317073|ref|ZP_00217651.1| COG0477: Permeases of the major f... 80 6e-14
gi|46321463|ref|ZP_00221840.1| COG0477: Permeases of the major f... 80 6e-14
gi|25029418|ref|NP_739472.1| putative transport protein [Coryneb... 80 6e-14
gi|48782368|ref|ZP_00278897.1| COG0477: Permeases of the major f... 79 8e-14
gi|27381529|ref|NP_773058.1| blr6418 [Bradyrhizobium japonicum U... 79 8e-14
gi|46313379|ref|ZP_00213969.1| COG0477: Permeases of the major f... 79 8e-14
gi|40787274|gb|AAR90191.1| putative permease [Rhodococcus sp. DK17] 79 8e-14
gi|21397926|ref|NP_653911.1| sugar_tr, Sugar (and other) transpo... 79 1e-13
gi|30023472|ref|NP_835103.1| Transporter, MFS superfamily [Bacil... 79 1e-13
gi|33521628|gb|AAQ21378.1| QbsN [Pseudomonas fluorescens] 79 1e-13
gi|29653712|ref|NP_819404.1| transporter, putative [Coxiella bur... 79 1e-13
gi|38638047|ref|NP_943021.1| putative muconolactone transporter ... 79 1e-13
gi|13541425|ref|NP_111113.1| Permease (major facilitator superfa... 79 1e-13
gi|46313035|ref|ZP_00213627.1| COG0477: Permeases of the major f... 79 1e-13
gi|45552907|ref|NP_995980.1| CG33234-PA [Drosophila melanogaster... 79 1e-13
gi|48787401|ref|ZP_00283483.1| COG0477: Permeases of the major f... 79 1e-13
gi|16660391|gb|AAL27558.1| vanillate transporter VanK [Pseudomon... 79 1e-13
gi|30265462|ref|NP_847839.1| major facilitator family transporte... 79 1e-13
gi|48787405|ref|ZP_00283487.1| COG0477: Permeases of the major f... 79 1e-13
gi|29833483|ref|NP_828117.1| putative transporter [Streptomyces ... 79 1e-13
gi|42784621|ref|NP_981868.1| major facilitator family transporte... 79 1e-13
gi|47568563|ref|ZP_00239262.1| major facilitator family protein,... 79 1e-13
gi|19554217|ref|NP_602219.1| putative benzoate transporter [Cory... 79 1e-13
gi|45545734|ref|ZP_00185862.1| COG0477: Permeases of the major f... 79 1e-13
gi|23015523|ref|ZP_00055297.1| COG0477: Permeases of the major f... 79 1e-13
gi|48732881|ref|ZP_00266624.1| COG0477: Permeases of the major f... 79 1e-13
gi|17549117|ref|NP_522457.1| PUTATIVE 4-HYDROXYBENZOATE TRANSPOR... 79 1e-13
gi|21325798|dbj|BAC00419.1| Permeases of the major facilitator s... 79 1e-13
gi|41223020|emb|CAF18965.1| putative benzoate transport protein ... 79 1e-13
gi|49480459|ref|YP_039433.1| transporter, MFS superfamily (major... 78 2e-13
gi|24649961|ref|NP_733086.1| CG31106-PA [Drosophila melanogaster... 78 2e-13
gi|26988110|ref|NP_743535.1| 4-hydroxybenzoate transporter [Pseu... 78 2e-13
gi|29654050|ref|NP_819742.1| major facilitator family transporte... 78 2e-13
gi|6093655|sp|Q51955|PCAK_PSEPU 4-hydroxybenzoate transporter >g... 78 2e-13
gi|14547929|sp|O30513|BENK_ACIAD Benzoate transport protein >gnl... 78 2e-13
gi|50084610|ref|YP_046120.1| benzoate transport protein (MFS sup... 78 2e-13
gi|19115046|ref|NP_594134.1| putative membrane transporter [Schi... 78 2e-13
gi|14324651|dbj|BAB59578.1| sugar transporter [Thermoplasma volc... 77 3e-13
gi|13541267|ref|NP_110955.1| Permease (major facilitator superfa... 77 3e-13
gi|12964666|dbj|BAB32694.1| putative transporter [Pseudomonas st... 77 3e-13
gi|14861219|gb|AAK73575.1| PmdK [Comamonas testosteroni] 77 3e-13
gi|37524995|ref|NP_928339.1| hypothetical protein [Photorhabdus ... 77 3e-13
gi|26991262|ref|NP_746687.1| major facilitator family transporte... 77 4e-13
gi|46187407|ref|ZP_00205330.1| COG0477: Permeases of the major f... 77 4e-13
gi|46130808|ref|ZP_00165710.2| COG0477: Permeases of the major f... 77 5e-13
gi|48866283|ref|ZP_00320139.1| COG0477: Permeases of the major f... 77 5e-13
gi|16119622|ref|NP_396328.1| AGR_pAT_571p [Agrobacterium tumefac... 77 5e-13
gi|26988430|ref|NP_743855.1| major facilitator family transporte... 76 7e-13
gi|48478156|ref|YP_023862.1| sugar transporter [Picrophilus torr... 76 7e-13
gi|32419947|ref|XP_330417.1| hypothetical protein [Neurospora cr... 76 7e-13
gi|6093708|sp|O24723|PHDK_NOCSK Probable 1-hydroxy-2-naphthoate ... 76 9e-13
gi|34499055|ref|NP_903270.1| 3-hydroxyphenylpropionic acid trans... 76 9e-13
gi|46432584|gb|EAK92059.1| hypothetical protein CaO19.6592 [Cand... 76 9e-13
gi|21325156|dbj|BAB99778.1| Permeases of the major facilitator s... 76 9e-13
gi|23468819|ref|ZP_00124154.1| COG0477: Permeases of the major f... 76 9e-13
gi|28869538|ref|NP_792157.1| 4-hydroxybenzoate transporter [Pseu... 76 9e-13
gi|16803021|ref|NP_464506.1| similar to efflux transporter [List... 76 9e-13
gi|47096313|ref|ZP_00233909.1| drug resistance transporter, EmrB... 76 9e-13
gi|46907214|ref|YP_013603.1| drug resistance transporter, EmrB/Q... 76 9e-13
gi|48769287|ref|ZP_00273633.1| COG0477: Permeases of the major f... 75 1e-12
gi|16081466|ref|NP_393813.1| inorganic phosphate transporter rel... 75 1e-12
gi|19553584|ref|NP_601586.1| permease of the major facilitator s... 75 1e-12
gi|48870523|ref|ZP_00323245.1| COG0477: Permeases of the major f... 75 1e-12
gi|50121184|ref|YP_050351.1| putative transporter [Erwinia carot... 75 1e-12
gi|15596216|ref|NP_249710.1| cis,cis-muconate transporter MucK [... 75 1e-12
gi|48781458|ref|ZP_00278066.1| COG0477: Permeases of the major f... 75 1e-12
gi|32041015|ref|ZP_00138598.1| COG0477: Permeases of the major f... 75 1e-12
gi|48789088|ref|ZP_00285067.1| COG0477: Permeases of the major f... 75 2e-12
gi|50084186|ref|YP_045696.1| vanillate transporter (MFS superfam... 75 2e-12
gi|46321737|ref|ZP_00222112.1| COG0477: Permeases of the major f... 75 2e-12
gi|48729704|ref|ZP_00263454.1| COG0477: Permeases of the major f... 75 2e-12
gi|46113179|ref|XP_383098.1| hypothetical protein FG02922.1 [Gib... 75 2e-12
gi|15643779|ref|NP_228827.1| permease, putative [Thermotoga mari... 75 2e-12
gi|48781599|ref|ZP_00278190.1| COG0477: Permeases of the major f... 75 2e-12
gi|11499596|ref|NP_070838.1| sugar transporter, putative [Archae... 75 2e-12
gi|16800049|ref|NP_470317.1| similar to efflux transporter [List... 75 2e-12
gi|46313791|ref|ZP_00214379.1| COG0477: Permeases of the major f... 75 2e-12
gi|44903463|emb|CAF32820.1| transport protein [Sphingobium herbi... 75 2e-12
gi|47220901|emb|CAG03108.1| unnamed protein product [Tetraodon n... 75 2e-12
gi|46315736|ref|ZP_00216317.1| COG0477: Permeases of the major f... 75 2e-12
gi|15597202|ref|NP_250696.1| probable MFS transporter [Pseudomon... 75 2e-12
gi|15920269|ref|NP_375938.1| 418aa long hypothetical transporter... 74 3e-12
gi|17945043|gb|AAL48583.1| RE06169p [Drosophila melanogaster] 74 3e-12
gi|28573097|ref|NP_650013.3| CG31272-PA [Drosophila melanogaster... 74 3e-12
gi|48732539|ref|ZP_00266282.1| COG0477: Permeases of the major f... 74 3e-12
gi|31206271|ref|XP_312087.1| ENSANGP00000016873 [Anopheles gambi... 74 3e-12
gi|16762099|ref|NP_457716.1| putative sialic acid transporter [S... 74 3e-12
gi|29143588|ref|NP_806930.1| putative sialic acid transporter [S... 74 3e-12
gi|48786706|ref|ZP_00282840.1| COG0477: Permeases of the major f... 74 3e-12
gi|46311220|ref|ZP_00211830.1| COG0477: Permeases of the major f... 74 3e-12
gi|45518878|ref|ZP_00170429.1| COG0477: Permeases of the major f... 74 3e-12
gi|15595432|ref|NP_248926.1| 4-hydroxybenzoate transporter PcaK ... 74 3e-12
gi|48789001|ref|ZP_00284980.1| COG0477: Permeases of the major f... 74 4e-12
gi|47094296|ref|ZP_00232000.1| drug resistance transporter, EmrB... 73 6e-12
gi|42631408|ref|ZP_00156946.1| COG0477: Permeases of the major f... 73 6e-12
gi|21219914|ref|NP_625693.1| putative transmembrane transport pr... 73 6e-12
gi|19552302|ref|NP_600304.1| permease of the major facilitator s... 73 6e-12
gi|46129026|ref|ZP_00155628.2| COG0477: Permeases of the major f... 73 7e-12
gi|46143452|ref|ZP_00135248.2| COG0477: Permeases of the major f... 73 7e-12
gi|46132136|ref|ZP_00170520.2| COG0477: Permeases of the major f... 73 7e-12
gi|48780825|ref|ZP_00277497.1| COG0477: Permeases of the major f... 73 7e-12
gi|48729223|ref|ZP_00262974.1| COG0477: Permeases of the major f... 72 1e-11
gi|49256171|gb|AAH73620.1| Unknown (protein for MGC:82937) [Xeno... 72 1e-11
gi|15597310|ref|NP_250804.1| probable MFS transporter [Pseudomon... 72 1e-11
gi|40019128|emb|CAE92852.1| putative permease [Pseudomonas putida] 72 1e-11
gi|15600096|ref|NP_253590.1| probable MFS transporter [Pseudomon... 72 1e-11
gi|15803758|ref|NP_289792.1| sialic acid transporter [Escherichi... 72 1e-11
gi|24114507|ref|NP_709017.1| sialic acid transporter [Shigella f... 72 1e-11
gi|49176328|ref|NP_417691.3| sialic acid transporter; sialic aci... 72 1e-11
gi|26249804|ref|NP_755844.1| Putative sialic acid transporter [E... 72 1e-11
gi|639470|gb|AAA86827.1| putative sialic acid transporter 72 1e-11
gi|16273030|ref|NP_439261.1| transporter protein [Haemophilus in... 72 1e-11
gi|31340235|sp|Q8FD59|NAT1_ECOL6 Putative sialic acid transporte... 72 1e-11
gi|38704151|ref|NP_312124.2| sialic acid transporter [Escherichi... 72 1e-11
gi|31340234|sp|P59699|NANT_SHIFL Putative sialic acid transporte... 72 1e-11
gi|1171644|sp|P41036|NANT_ECOLI Putative sialic acid transporter... 72 1e-11
gi|16758302|ref|NP_445989.1| solute carrier family 22 member 7 [... 72 1e-11
gi|48096299|ref|XP_394660.1| similar to ENSANGP00000016873 [Apis... 72 1e-11
gi|50842173|ref|YP_055400.1| sialic acid transporter [Propioniba... 72 2e-11
gi|46314864|ref|ZP_00215448.1| COG0477: Permeases of the major f... 72 2e-11
gi|31209329|ref|XP_313631.1| ENSANGP00000013027 [Anopheles gambi... 72 2e-11
gi|49135163|ref|XP_413272.1| hypothetical protein AN9135.2 [Aspe... 72 2e-11
gi|2935476|gb|AAC64693.1| synaptic vesicle protein 2 [Aedes albo... 72 2e-11
gi|13541874|ref|NP_111562.1| Permease (major facilitator superfa... 71 2e-11
gi|49093698|ref|XP_408310.1| hypothetical protein AN4173.2 [Aspe... 71 2e-11
gi|46127007|ref|XP_388057.1| hypothetical protein FG07881.1 [Gib... 71 2e-11
gi|14325309|dbj|BAB60213.1| hypothetical protein [Thermoplasma v... 71 2e-11
gi|48771913|ref|ZP_00276255.1| COG0477: Permeases of the major f... 71 2e-11
gi|26990369|ref|NP_745794.1| aromatic compound MFS transporter, ... 71 2e-11
gi|45442416|ref|NP_993955.1| putative sugar transporter [Yersini... 71 3e-11
gi|48477625|ref|YP_023331.1| phosphate transporter [Picrophilus ... 71 3e-11
gi|48824499|ref|ZP_00285869.1| COG0477: Permeases of the major f... 71 3e-11
gi|46133841|ref|XP_389236.1| hypothetical protein FG09060.1 [Gib... 71 3e-11
gi|46310812|ref|ZP_00211432.1| COG0477: Permeases of the major f... 70 4e-11
gi|46314462|ref|ZP_00215048.1| COG0477: Permeases of the major f... 70 4e-11
gi|26249472|ref|NP_755512.1| Putative sialic acid transporter [E... 70 4e-11
gi|47600668|emb|CAE55790.1| putative sialic acid transporter 2 [... 70 4e-11
gi|16081573|ref|NP_393930.1| sugar transport protein related pro... 70 5e-11
gi|16123195|ref|NP_406508.1| putative sugar transporter [Yersini... 70 5e-11
gi|21450073|ref|NP_659105.1| solute carrier family 22 member 7 [... 70 5e-11
gi|21698924|dbj|BAC02736.1| organic anion transporter 2 [Mus mus... 70 5e-11
gi|15602700|ref|NP_245772.1| unknown [Pasteurella multocida Pm70... 70 5e-11
gi|3916012|sp|P39352|YJHB_ECOLI Hypothetical metabolite transpor... 70 5e-11
gi|49176483|ref|NP_418699.3| putative transport protein; KpLE2 p... 70 5e-11
gi|16122178|ref|NP_405491.1| putative sugar transporter [Yersini... 70 6e-11
gi|22126263|ref|NP_669686.1| putative major facilitator superfam... 70 6e-11
gi|42518600|ref|NP_964530.1| major facilitator superfamily perme... 70 6e-11
gi|45518497|ref|ZP_00170048.1| COG0477: Permeases of the major f... 70 6e-11
gi|17549018|ref|NP_522358.1| PROBABLE TRANSPORT TRANSMEMBRANE PR... 69 8e-11
gi|23003645|ref|ZP_00047301.1| COG0477: Permeases of the major f... 69 8e-11
gi|13470951|ref|NP_102520.1| probable membrane transport protein... 69 8e-11
gi|45515215|ref|ZP_00166770.1| COG0477: Permeases of the major f... 69 8e-11
gi|13516857|dbj|BAB40582.1| membrane transport protein [Arthroba... 69 1e-10
gi|42538738|emb|CAF28454.1| organic anion transporter 2 [Bos tau... 69 1e-10
gi|9294345|dbj|BAB02242.1| organic anion transporter-like protei... 69 1e-10
gi|16760010|ref|NP_455627.1| putative transporter [Salmonella en... 69 1e-10
gi|16764489|ref|NP_460104.1| putative sugar transport protein [S... 69 1e-10
gi|46315658|ref|ZP_00216240.1| COG0477: Permeases of the major f... 69 1e-10
gi|49078536|ref|XP_403011.1| conserved hypothetical protein [Ust... 69 1e-10
gi|23114852|ref|ZP_00100132.1| COG0477: Permeases of the major f... 69 1e-10
gi|48849650|ref|ZP_00303893.1| COG0477: Permeases of the major f... 69 1e-10
gi|16080636|ref|NP_391464.1| ywtG [Bacillus subtilis subsp. subt... 69 1e-10
gi|23468623|ref|ZP_00123958.1| COG0477: Permeases of the major f... 69 1e-10
gi|50255838|gb|EAL18570.1| hypothetical protein CNBJ2110 [Crypto... 69 1e-10
gi|46321648|ref|ZP_00222023.1| COG0477: Permeases of the major f... 68 2e-10
gi|17548455|ref|NP_521795.1| PROBABLE METABOLITE TRANSPORT TRANS... 68 2e-10
gi|24497499|ref|NP_004245.2| solute carrier family 22 member 8; ... 68 2e-10
gi|14017758|dbj|BAB47393.1| organic anion transporter 3 [Homo sa... 68 2e-10
gi|48852376|ref|ZP_00306563.1| COG0477: Permeases of the major f... 68 2e-10
gi|31204637|ref|XP_311267.1| ENSANGP00000017567 [Anopheles gambi... 68 2e-10
gi|46312922|ref|ZP_00213515.1| COG0477: Permeases of the major f... 68 2e-10
gi|16082283|ref|NP_394743.1| probable inorganic phosphate transp... 68 2e-10
gi|48785859|ref|ZP_00282068.1| COG0477: Permeases of the major f... 68 2e-10
gi|26350039|dbj|BAC38659.1| unnamed protein product [Mus musculus] 68 2e-10
gi|37142938|gb|AAQ88394.1| SV2-like protein 1 [Ctenocephalides f... 68 2e-10
gi|29831729|ref|NP_826363.1| putative sugar transport protein [S... 68 2e-10
gi|41054782|ref|NP_956643.1| hypothetical protein MGC63958 [Dani... 68 2e-10
gi|49481530|ref|YP_038755.1| multidrug resistance protein B [Bac... 67 3e-10
gi|42783897|ref|NP_981144.1| drug resistance transporter, EmrB/Q... 67 3e-10
gi|47221414|emb|CAF97332.1| unnamed protein product [Tetraodon n... 67 3e-10
gi|20072361|gb|AAH26598.1| Solute carrier family 22 member 7 [Mu... 67 3e-10
gi|45916269|ref|ZP_00197413.1| COG0477: Permeases of the major f... 67 3e-10
gi|50842371|ref|YP_055598.1| sugar transporter, permease protein... 67 3e-10
gi|25027192|ref|NP_737246.1| putative transport protein [Coryneb... 67 3e-10
gi|50843465|ref|YP_056692.1| transporter permease [Propionibacte... 67 3e-10
gi|46442793|gb|EAL02080.1| hypothetical protein CaO19.13931 [Can... 67 3e-10
gi|7514032|pir||S50862 organic cation transport protein OCT1 - rat 67 4e-10
gi|31982010|ref|NP_033228.2| solute carrier family 22 member 1; ... 67 4e-10
gi|6981300|ref|NP_036829.1| solute carrier family 22, member 1; ... 67 4e-10
gi|1053142|gb|AAB19097.1| LX1 67 4e-10
gi|12003293|gb|AAG43523.1| organic anion transporter 2 [Homo sap... 67 4e-10
gi|47565135|ref|ZP_00236178.1| drug resistance transporter, EmrB... 67 4e-10
gi|21402754|ref|NP_658739.1| sugar_tr, Sugar (and other) transpo... 67 4e-10
gi|48823779|ref|ZP_00285271.1| COG0477: Permeases of the major f... 67 4e-10
gi|30022780|ref|NP_834411.1| Multidrug resistance protein B [Bac... 67 4e-10
gi|24497497|ref|NP_006663.2| solute carrier family 22 member 7 i... 67 4e-10
gi|13786160|ref|NP_112622.1| solute carrier family 22 ,member 8;... 67 5e-10
gi|48852954|ref|ZP_00307136.1| COG0477: Permeases of the major f... 67 5e-10
gi|48783120|ref|ZP_00279582.1| COG0477: Permeases of the major f... 67 5e-10
gi|49183377|ref|YP_026629.1| benzoate transport protein, putativ... 67 5e-10
gi|1905993|gb|AAB81315.1| putative 3-(3-hydroxyphenyl) propionat... 67 5e-10
gi|15898918|ref|NP_343523.1| Sugar transport related protein [Su... 67 5e-10
gi|21398312|ref|NP_654297.1| sugar_tr, Sugar (and other) transpo... 67 5e-10
gi|47569422|ref|ZP_00240104.1| benzoate MFS transporter BenK [Ba... 67 5e-10
gi|25029271|ref|NP_739325.1| putative transport protein [Coryneb... 66 7e-10
gi|15004834|ref|NP_149294.1| Permease, MDR related [Clostridium ... 66 7e-10
gi|23115658|ref|ZP_00100617.1| COG0477: Permeases of the major f... 66 7e-10
gi|50732205|ref|XP_418528.1| PREDICTED: similar to Solute carrie... 66 7e-10
gi|21221338|ref|NP_627117.1| putative sugar transport protein. [... 66 9e-10
gi|42779544|ref|NP_976791.1| benzoate transport protein, putativ... 66 9e-10
gi|15899884|ref|NP_344489.1| Phosphate transporter related prote... 65 1e-09
gi|15965830|ref|NP_386183.1| PUTATIVE TRANSPORT PROTEIN [Sinorhi... 65 1e-09
gi|48780932|ref|ZP_00277595.1| COG0477: Permeases of the major f... 65 1e-09
gi|32306889|gb|AAP78948.1| putative hydroxycinnamate transporter... 65 1e-09
gi|28869693|ref|NP_792312.1| major facilitator family transporte... 65 1e-09
gi|28378058|ref|NP_784950.1| multidrug transport protein [Lactob... 65 2e-09
gi|48781657|ref|ZP_00278248.1| COG0477: Permeases of the major f... 65 2e-09
gi|34497871|ref|NP_902086.1| probable transport transmembrane pr... 65 2e-09
gi|47575838|ref|NP_001001261.1| putative organic anion transport... 65 2e-09
gi|24649963|ref|NP_733087.1| CG31103-PA [Drosophila melanogaster... 65 2e-09
gi|16759335|ref|NP_454952.1| putative metabolite transport prote... 65 2e-09
gi|29249754|gb|EAA41259.1| GLP_190_6164_7921 [Giardia lamblia AT... 65 2e-09
gi|14289342|gb|AAK58907.1| benzoate transport protein [Rhodococc... 65 2e-09
gi|4584857|gb|AAD25166.1| putative 4-chlorobenzoate transporter ... 64 3e-09
gi|24497478|ref|NP_695009.1| solute carrier family 22 member 6 i... 64 3e-09
gi|46317236|ref|ZP_00217814.1| COG0477: Permeases of the major f... 64 3e-09
gi|20070188|ref|NP_004781.2| solute carrier family 22 member 6 i... 64 3e-09
gi|21241123|ref|NP_640705.1| MFS transporter [Xanthomonas axonop... 64 3e-09
gi|24497482|ref|NP_695011.1| solute carrier family 22 member 6 i... 64 3e-09
gi|24497476|ref|NP_695008.1| solute carrier family 22 member 6 i... 64 3e-09
gi|3831566|gb|AAC70004.1| putative renal organic anion transport... 64 3e-09
gi|4193819|gb|AAD10052.1| para-aminohippurate transporter [Homo ... 64 3e-09
gi|47224748|emb|CAG00342.1| unnamed protein product [Tetraodon n... 64 3e-09
gi|24497480|ref|NP_695010.1| solute carrier family 22 member 6 i... 64 3e-09
gi|45549297|ref|NP_569876.3| CG3690-PA [Drosophila melanogaster]... 64 3e-09
gi|46113279|ref|ZP_00182596.2| COG0477: Permeases of the major f... 64 3e-09
gi|50255839|gb|EAL18571.1| hypothetical protein CNBJ2120 [Crypto... 64 3e-09
gi|42538740|emb|CAF28455.1| organic anion transporter 3 [Bos tau... 64 3e-09
gi|8712877|gb|AAF78822.1| 4-chlorobenzoate transport protein [Ar... 64 3e-09
gi|37519837|ref|NP_923214.1| similar to multidrug-efflux transpo... 64 3e-09
gi|29828839|ref|NP_823473.1| putative sugar transporter [Strepto... 64 3e-09
gi|50084849|ref|YP_046359.1| transport protein in catabolism of ... 64 3e-09
gi|19387957|gb|AAH25813.1| Slc22a7 protein [Mus musculus] 64 3e-09
gi|16763736|ref|NP_459351.1| putative inner membrane protein [Sa... 64 3e-09
gi|4467970|emb|CAB37973.1| hypothetical protein [Myxococcus xant... 64 3e-09
gi|15812043|gb|AAL09095.1| DcaK [Acinetobacter sp. ADP1] 64 3e-09
gi|3236340|gb|AAC23661.1| renal organic cation transporter [Oryc... 64 3e-09
gi|27378986|ref|NP_770515.1| hypothetical metabolite transport p... 64 3e-09
gi|45516731|ref|ZP_00168283.1| COG0477: Permeases of the major f... 64 3e-09
gi|6562698|emb|CAB62587.1| renal organic anion transporter 1 (rb... 64 3e-09
gi|48783655|ref|ZP_00280107.1| COG0477: Permeases of the major f... 64 3e-09
gi|23469181|ref|ZP_00124516.1| COG0477: Permeases of the major f... 64 5e-09
gi|15894624|ref|NP_347973.1| D-xylose-proton symporter [Clostrid... 64 5e-09
gi|46442227|gb|EAL01518.1| hypothetical protein CaO19.7071 [Cand... 64 5e-09
gi|47213390|emb|CAF93343.1| unnamed protein product [Tetraodon n... 64 5e-09
gi|50756085|ref|XP_415009.1| PREDICTED: similar to solute carrie... 64 5e-09
gi|48477165|ref|YP_022871.1| phosphate transporter [Picrophilus ... 63 6e-09
gi|15841373|ref|NP_336410.1| sugar transporter family protein [M... 63 6e-09
gi|30018606|ref|NP_830237.1| Benzoate transport protein [Bacillu... 63 6e-09
gi|26986131|emb|CAD34035.1| renal organic anion transporter 3 [O... 63 6e-09
gi|29831245|ref|NP_825879.1| putative exporter [Streptomyces ave... 63 6e-09
gi|48478225|ref|YP_023931.1| transporter [Picrophilus torridus D... 63 6e-09
gi|23115039|ref|ZP_00100314.1| COG0477: Permeases of the major f... 63 6e-09
gi|48731306|ref|ZP_00265051.1| COG0477: Permeases of the major f... 63 6e-09
gi|15609039|ref|NP_216418.1| nanT [Mycobacterium tuberculosis H3... 63 6e-09
gi|48477158|ref|YP_022864.1| transporter [Picrophilus torridus D... 63 6e-09
gi|41407724|ref|NP_960560.1| NanT [Mycobacterium avium subsp. pa... 63 8e-09
gi|48781162|ref|ZP_00277806.1| COG0477: Permeases of the major f... 63 8e-09
gi|27372188|dbj|BAC53618.1| organic anion transporter 3 [Mus mus... 63 8e-09
gi|48788318|ref|ZP_00284297.1| COG0477: Permeases of the major f... 63 8e-09
gi|48852306|ref|ZP_00306494.1| COG0477: Permeases of the major f... 63 8e-09
gi|3915309|sp|O52733|XYLT_LACBR D-xylose-proton symporter (D-xyl... 63 8e-09
gi|15928575|gb|AAH14762.1| Solute carrier family 22 member 8 [Mu... 63 8e-09
gi|3511277|gb|AAC61265.1| reduced in osteosclerosis transporter ... 63 8e-09
gi|31543719|ref|NP_112471.2| solute carrier family 22 member 8; ... 63 8e-09
gi|49235151|ref|ZP_00329224.1| COG0477: Permeases of the major f... 63 8e-09
gi|46131522|ref|ZP_00169763.2| COG0477: Permeases of the major f... 63 8e-09
gi|15230501|ref|NP_190717.1| sugar transporter family protein [A... 63 8e-09
gi|21221795|ref|NP_627574.1| putative exporter [Streptomyces coe... 63 8e-09
gi|46317722|ref|ZP_00218300.1| COG0477: Permeases of the major f... 63 8e-09
gi|15678132|ref|NP_275247.1| multidrug transporter homolog [Meth... 63 8e-09
gi|5001689|gb|AAD37091.1| liver-specific transporter [Homo sapie... 63 8e-09
gi|17549814|ref|NP_523154.1| PROBABLE METABOLITE TRANSPORT TRANS... 62 1e-08
gi|48850934|ref|ZP_00305176.1| COG0477: Permeases of the major f... 62 1e-08
gi|29375376|ref|NP_814530.1| drug resistance transporter, EmrB/Q... 62 1e-08
gi|15899835|ref|NP_344440.1| Transporter [Sulfolobus solfataricu... 62 1e-08
gi|49135788|ref|XP_413312.1| hypothetical protein AN9175.2 [Aspe... 62 1e-08
gi|50547223|ref|XP_501081.1| hypothetical protein [Yarrowia lipo... 62 1e-08
gi|15898361|ref|NP_342966.1| Multidrug resistance transporter re... 62 1e-08
gi|48782637|ref|ZP_00279143.1| COG0477: Permeases of the major f... 62 1e-08
gi|41723569|ref|ZP_00150479.1| COG2814: Arabinose efflux permeas... 62 1e-08
gi|23105460|ref|ZP_00091916.1| COG0477: Permeases of the major f... 62 1e-08
gi|48865624|ref|ZP_00319483.1| COG0477: Permeases of the major f... 62 1e-08
gi|42561831|ref|NP_172364.3| sugar transporter family protein [A... 62 1e-08
gi|16121842|ref|NP_405155.1| putative sugar transporter [Yersini... 62 1e-08
gi|27380756|ref|NP_772285.1| bll5645 [Bradyrhizobium japonicum U... 62 1e-08
gi|45201171|ref|NP_986741.1| AGR076Cp [Eremothecium gossypii] >g... 62 1e-08
gi|42518669|ref|NP_964599.1| major facilitator superfamily perme... 62 1e-08
gi|45441283|ref|NP_992822.1| putative sugar transporter [Yersini... 62 1e-08
gi|29828156|ref|NP_822790.1| putative benzoate transport protein... 62 2e-08
gi|38234711|ref|NP_940478.1| probable integral membrane transpor... 62 2e-08
gi|16081842|ref|NP_394237.1| sugar transport protein related pro... 62 2e-08
gi|16081225|ref|NP_393527.1| phosphate permease related protein ... 62 2e-08
gi|48770036|ref|ZP_00274380.1| COG0477: Permeases of the major f... 62 2e-08
gi|45518799|ref|ZP_00170350.1| COG0477: Permeases of the major f... 62 2e-08
gi|34861829|ref|XP_219524.2| similar to solute carrier family 22... 62 2e-08
gi|47218461|emb|CAG03733.1| unnamed protein product [Tetraodon n... 62 2e-08
gi|28870902|ref|NP_793521.1| drug resistance transporter, EmrB/Q... 62 2e-08
gi|47564042|ref|NP_001001143.1| organic anion transporter 1 [Bos... 62 2e-08
gi|13541134|ref|NP_110822.1| Phosphate transport permease [Therm... 62 2e-08
gi|46128065|ref|XP_388586.1| hypothetical protein FG08410.1 [Gib... 62 2e-08
gi|28871437|ref|NP_794056.1| drug resistance transporter, EmrB/Q... 62 2e-08
gi|21225705|ref|NP_631484.1| putative transmembrane transport pr... 62 2e-08
gi|16082368|ref|NP_394845.1| phosphate transporter related prote... 62 2e-08
gi|50084881|ref|YP_046391.1| transporter of hydroxycinnamates (M... 62 2e-08
gi|22125547|ref|NP_668970.1| putative sugar transporter [Yersini... 61 2e-08
gi|14324338|dbj|BAB59266.1| metabolite transporter [Thermoplasma... 61 2e-08
gi|16122753|ref|NP_406066.1| putative sugar transporter [Yersini... 61 2e-08
gi|46324556|ref|ZP_00224916.1| COG0477: Permeases of the major f... 61 2e-08
gi|27375806|ref|NP_767335.1| major facilitator superfamily trans... 61 2e-08
gi|13540954|ref|NP_110642.1| Phosphate transport permease [Therm... 61 2e-08
gi|15921252|ref|NP_376921.1| 473aa long hypothetical multidrug r... 61 2e-08
gi|31194587|ref|XP_306241.1| ENSANGP00000000030 [Anopheles gambi... 61 2e-08
gi|48730351|ref|ZP_00264099.1| COG0477: Permeases of the major f... 61 3e-08
gi|42567984|ref|NP_197538.2| transporter-related [Arabidopsis th... 61 3e-08
gi|47222721|emb|CAG00155.1| unnamed protein product [Tetraodon n... 61 3e-08
gi|23510410|ref|NP_694857.1| solute carrier family 22 member 1 i... 61 3e-08
gi|8918937|emb|CAB95971.1| oct1_cds [Homo sapiens] 61 3e-08
gi|4506999|ref|NP_003048.1| solute carrier family 22 member 1 is... 61 3e-08
gi|48478323|ref|YP_024029.1| putative sugar transporter [Picroph... 60 4e-08
gi|22970851|ref|ZP_00017873.1| hypothetical protein [Chloroflexu... 60 4e-08
gi|23121602|ref|ZP_00103843.1| COG0477: Permeases of the major f... 60 4e-08
gi|27375435|ref|NP_766964.1| bll0324 [Bradyrhizobium japonicum U... 60 4e-08
gi|4138724|emb|CAA04511.1| hexose transporter [Vitis vinifera] 60 4e-08
gi|4138722|emb|CAA70777.1| hexose transporter [Vitis vinifera] 60 4e-08
gi|48852391|ref|ZP_00306578.1| COG0477: Permeases of the major f... 60 4e-08
gi|48786522|ref|ZP_00282656.1| COG0477: Permeases of the major f... 60 4e-08
gi|18314015|ref|NP_560682.1| antibiotic resistance (efflux) prot... 60 5e-08
>gi|32564663|ref|NP_498960.2| general substrate transporter (57.2
kD) (3J974) [Caenorhabditis elegans]
gi|44889001|sp|P30638|YOU1_CAEEL Hypothetical protein ZK637.1 in
chromosome III
gi|24817510|emb|CAA80131.2| Hypothetical protein ZK637.1
[Caenorhabditis elegans]
gi|25005169|emb|CAA77460.2| Hypothetical protein ZK637.1
[Caenorhabditis elegans]
Length = 520
Score = 505 bits (1301), Expect = e-142
Identities = 255/255 (100%), Positives = 255/255 (100%)
Frame = -1
Query: 765 MGDKAILTEVLEASNLTEAYVDLTAKQLIKEIRHVGDDFAVRYSNLDDRTELGEPTDQRS 586
MGDKAILTEVLEASNLTEAYVDLTAKQLIKEIRHVGDDFAVRYSNLDDRTELGEPTDQRS
Sbjct: 1 MGDKAILTEVLEASNLTEAYVDLTAKQLIKEIRHVGDDFAVRYSNLDDRTELGEPTDQRS 60
Query: 585 PDSEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQ 406
PDSEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQ
Sbjct: 61 PDSEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQ 120
Query: 405 QALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRG 226
QALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRG
Sbjct: 121 QALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRG 180
Query: 225 LTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALM 46
LTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALM
Sbjct: 181 LTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALM 240
Query: 45 FLSSLPLGIFAVASF 1
FLSSLPLGIFAVASF
Sbjct: 241 FLSSLPLGIFAVASF 255
>gi|7511251|pir||T23190 hypothetical protein ZK637.1 -
Caenorhabditis elegans
Length = 529
Score = 505 bits (1301), Expect = e-142
Identities = 255/255 (100%), Positives = 255/255 (100%)
Frame = -1
Query: 765 MGDKAILTEVLEASNLTEAYVDLTAKQLIKEIRHVGDDFAVRYSNLDDRTELGEPTDQRS 586
MGDKAILTEVLEASNLTEAYVDLTAKQLIKEIRHVGDDFAVRYSNLDDRTELGEPTDQRS
Sbjct: 1 MGDKAILTEVLEASNLTEAYVDLTAKQLIKEIRHVGDDFAVRYSNLDDRTELGEPTDQRS 60
Query: 585 PDSEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQ 406
PDSEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQ
Sbjct: 61 PDSEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQ 120
Query: 405 QALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRG 226
QALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRG
Sbjct: 121 QALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRG 180
Query: 225 LTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALM 46
LTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALM
Sbjct: 181 LTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALM 240
Query: 45 FLSSLPLGIFAVASF 1
FLSSLPLGIFAVASF
Sbjct: 241 FLSSLPLGIFAVASF 255
>gi|102506|pir||S15786 glucose transport protein homolog -
Caenorhabditis elegans (fragment)
Length = 300
Score = 505 bits (1301), Expect = e-142
Identities = 255/255 (100%), Positives = 255/255 (100%)
Frame = -1
Query: 765 MGDKAILTEVLEASNLTEAYVDLTAKQLIKEIRHVGDDFAVRYSNLDDRTELGEPTDQRS 586
MGDKAILTEVLEASNLTEAYVDLTAKQLIKEIRHVGDDFAVRYSNLDDRTELGEPTDQRS
Sbjct: 1 MGDKAILTEVLEASNLTEAYVDLTAKQLIKEIRHVGDDFAVRYSNLDDRTELGEPTDQRS 60
Query: 585 PDSEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQ 406
PDSEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQ
Sbjct: 61 PDSEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQ 120
Query: 405 QALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRG 226
QALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRG
Sbjct: 121 QALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRG 180
Query: 225 LTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALM 46
LTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALM
Sbjct: 181 LTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALM 240
Query: 45 FLSSLPLGIFAVASF 1
FLSSLPLGIFAVASF
Sbjct: 241 FLSSLPLGIFAVASF 255