Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK652_9
(210 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17557043|ref|NP_498707.1| copper (CU) Chaperonin, functional,... 139 2e-32
gi|630769|pir||S44900 ZK652.10 protein - Caenorhabditis elegans 139 2e-32
gi|39589638|emb|CAE66873.1| Hypothetical protein CBG12251 [Caeno... 129 2e-29
gi|24668286|ref|NP_730672.1| CG32446-PA [Drosophila melanogaster... 65 4e-10
gi|13787052|pdb|1FD8|A Chain A, Solution Structure Of The Cu(I) ... 60 2e-08
gi|6324070|ref|NP_014140.1| Cytosolic copper metallochaperone th... 60 2e-08
gi|45270624|gb|AAS56693.1| YNL259C [Saccharomyces cerevisiae] 59 2e-08
gi|47215072|emb|CAG04526.1| unnamed protein product [Tetraodon n... 59 3e-08
gi|19112235|ref|NP_595443.1| putative metal homeostasis factor [... 57 1e-07
gi|50304721|ref|XP_452316.1| unnamed protein product [Kluyveromy... 55 4e-07
gi|45199172|ref|NP_986201.1| AFR653Wp [Eremothecium gossypii] >g... 55 5e-07
gi|50423359|ref|XP_460262.1| unnamed protein product [Debaryomyc... 54 9e-07
gi|6013208|gb|AAF01286.1| copper chaperone [Canis familiaris] >g... 53 2e-06
gi|7531050|sp|Q9XT28|ATOX_SHEEP Copper transport protein ATOX1 (... 52 3e-06
gi|11290108|pir||T50779 copper chaperone homolog CCH [imported] ... 52 3e-06
gi|4757804|ref|NP_004036.1| antioxidant protein 1; metal transpo... 52 3e-06
gi|48145919|emb|CAG33182.1| ATOX1 [Homo sapiens] 52 3e-06
gi|49087086|ref|XP_405527.1| hypothetical protein AN1390.2 [Aspe... 51 6e-06
gi|11290106|pir||T50778 copper chaperone homolog CCH [imported] ... 51 8e-06
gi|6753136|ref|NP_033850.1| antioxidant protein 1 [Mus musculus]... 49 2e-05
gi|47176684|gb|AAT12488.1| copper chaperone [Populus alba x Popu... 49 3e-05
gi|46138679|ref|XP_391030.1| hypothetical protein FG10854.1 [Gib... 49 3e-05
gi|30039180|gb|AAP06757.1| copper chaperone [Lycopersicon escule... 49 4e-05
gi|16758088|ref|NP_445811.1| ATX1 (antioxidant protein 1) homolo... 49 4e-05
gi|40253404|dbj|BAD05334.1| putative copper chaperone [Oryza sat... 48 5e-05
gi|18408466|ref|NP_564870.1| copper homeostasis factor, putative... 48 6e-05
gi|15228869|ref|NP_191183.1| copper homeostasis factor / copper ... 47 8e-05
gi|37651975|emb|CAE51321.1| chopper chaperone [Hordeum vulgare s... 47 1e-04
gi|25404599|pir||D96687 hypothetical protein T6J19.6 [imported] ... 46 2e-04
gi|38108401|gb|EAA54422.1| hypothetical protein MG02407.4 [Magna... 45 5e-04
gi|25956321|gb|AAN75572.1| copper chaperone TahA [Trametes versi... 44 0.001
gi|32404026|ref|XP_322626.1| predicted protein [Neurospora crass... 43 0.002
gi|9885429|gb|AAG01446.1| putative copper chaperone [Chlamydomon... 42 0.004
gi|46203859|ref|ZP_00050881.2| COG2608: Copper chaperone [Magnet... 41 0.008
gi|50258199|gb|EAL20893.1| hypothetical protein CNBE2540 [Crypto... 40 0.010
gi|50418349|gb|AAH77488.1| Unknown (protein for MGC:82563) [Xeno... 40 0.018
gi|3929319|gb|AAC79870.1| putative copper/zinc superoxide dismut... 38 0.051
gi|15236529|ref|NP_192597.1| heavy-metal-associated domain-conta... 38 0.067
gi|37806140|dbj|BAC99589.1| unknown protein [Oryza sativa (japon... 37 0.087
gi|23098597|ref|NP_692063.1| copper-transporting ATPase [Oceanob... 37 0.087
gi|34909690|ref|NP_916192.1| B1131G08.3 [Oryza sativa (japonica ... 37 0.087
gi|15645687|ref|NP_207864.1| copper ion binding protein (copP) [... 37 0.087
gi|45680423|gb|AAS75224.1| unknown protein [Oryza sativa (japoni... 37 0.11
gi|48843833|gb|AAT47092.1| unknown protein [Oryza sativa (japoni... 37 0.11
gi|8393066|ref|NP_058588.1| copper chaperone for superoxide dism... 37 0.11
gi|37654464|gb|AAP34306.1| copper chaperone precursor [Solanum t... 37 0.15
gi|50591442|ref|ZP_00332753.1| COG2217: Cation transport ATPase ... 37 0.15
gi|4826665|ref|NP_005116.1| copper chaperone for superoxide dism... 37 0.15
gi|21429608|gb|AAM50090.1| superoxide dismutase copper chaperone... 37 0.15
gi|15611420|ref|NP_223071.1| copper-associated protein [Helicoba... 36 0.25
gi|495029|gb|AAB67321.1| copper ion binding protein [Helicobacte... 36 0.25
gi|1477773|gb|AAB05476.1| CopP [Helicobacter pylori] 36 0.25
gi|15241025|ref|NP_198121.1| heavy-metal-associated domain-conta... 36 0.25
gi|16758084|ref|NP_445877.1| copper chaperone for superoxide dis... 36 0.25
gi|5815465|gb|AAD52685.1| Cu/Zn-superoxide dismutase copper chap... 35 0.33
gi|12711645|gb|AAK01931.1| Cu/Zn-superoxide dismutase copper cha... 35 0.33
gi|18391404|ref|NP_563910.1| superoxide dismutase copper chapero... 35 0.33
gi|25402730|pir||D86259 protein T12C24.6 [imported] - Arabidopsi... 35 0.33
gi|25456033|pir||T52130 probable copper/zinc superoxide dismutas... 35 0.33
gi|21911027|ref|NP_665295.1| putative copper-transporting ATPase... 35 0.43
gi|19746619|ref|NP_607755.1| putative cation-transporting ATP-as... 35 0.43
gi|34906086|ref|NP_914390.1| P0459B04.21 [Oryza sativa (japonica... 35 0.43
gi|5759320|gb|AAD12307.2| putative copper/zinc superoxide dismut... 35 0.57
gi|47212233|emb|CAF96200.1| unnamed protein product [Tetraodon n... 35 0.57
gi|34910670|ref|NP_916682.1| P0480C01.26 [Oryza sativa (japonica... 35 0.57
gi|34902222|ref|NP_912457.1| Hypothetical protein [Oryza sativa ... 34 0.74
gi|23092567|gb|AAN08440.1| hypothetical protein [Arabidopsis tha... 34 0.74
gi|30687119|ref|NP_181275.2| heavy-metal-associated domain-conta... 34 0.74
gi|30687142|ref|NP_850851.1| heavy-metal-associated domain-conta... 34 0.74
gi|44917509|gb|AAS49079.1| At2g18196 [Arabidopsis thaliana] 34 0.74
gi|15896888|ref|NP_350237.1| Heavy-metal transporting P-type ATP... 34 0.74
gi|42570277|ref|NP_849973.2| copper chaperone (CCH)-related [Ara... 34 0.74
gi|15235984|ref|NP_195680.1| heavy-metal-associated domain-conta... 34 0.74
gi|11358280|pir||T46133 hypothetical protein T2J13.190 - Arabido... 34 0.74
gi|15239643|ref|NP_197410.1| heavy-metal-associated domain-conta... 34 0.74
gi|18408744|ref|NP_566913.1| copper-binding family protein [Arab... 34 0.74
gi|21554311|gb|AAM63416.1| unknown [Arabidopsis thaliana] 34 0.74
gi|22536568|ref|NP_687419.1| copper-transporter ATPase CopA [Str... 34 0.96
gi|15672816|ref|NP_266990.1| copper/potassium-transporting ATPas... 34 0.96
gi|25406916|pir||A86199 hypothetical protein [imported] - Arabid... 34 0.96
gi|42573397|ref|NP_974795.1| heavy-metal-associated domain-conta... 34 0.96
gi|19554151|ref|NP_602153.1| hypothetical protein NCgl2860 [Cory... 34 0.96
gi|11358213|pir||T48281 hypothetical protein T22P11.190 - Arabid... 34 0.96
gi|18397481|ref|NP_566273.1| heavy-metal-associated domain-conta... 34 0.96
gi|15221451|ref|NP_172122.1| copper-binding family protein [Arab... 34 0.96
gi|18413973|ref|NP_568105.1| heavy-metal-associated domain-conta... 34 0.96
gi|15237967|ref|NP_197247.1| heavy-metal-associated domain-conta... 34 0.96
gi|21219561|ref|NP_625340.1| putative metal associated protein [... 33 1.3
gi|15677191|ref|NP_274344.1| cation transport ATPase, E1-E2 fami... 33 1.3
gi|44004521|ref|NP_982189.1| copper-translocating P-type ATPase ... 33 1.3
gi|30679432|ref|NP_187173.2| heavy-metal-associated domain-conta... 33 1.3
gi|15794432|ref|NP_284254.1| putative cation-transporting ATPase... 33 1.3
gi|50085487|ref|YP_046997.1| P-type ATPase, copper transporting ... 33 1.6
gi|21554184|gb|AAM63263.1| unknown [Arabidopsis thaliana] 33 1.6
gi|18404191|ref|NP_566747.1| copper-binding family protein [Arab... 33 1.6
gi|48856988|ref|ZP_00311145.1| COG2217: Cation transport ATPase ... 33 2.1
gi|27469037|ref|NP_765674.1| copper-transporting ATPase copA [St... 33 2.1
gi|46116564|ref|XP_384300.1| hypothetical protein FG04124.1 [Gib... 33 2.1
gi|15218813|ref|NP_174205.1| copper-binding family protein [Arab... 33 2.1
gi|15675567|ref|NP_269741.1| putative cation-transporting ATP-as... 33 2.1
gi|49274647|ref|NP_001001866.1| superoxide dismutase copper chap... 33 2.1
gi|49097444|ref|XP_410182.1| hypothetical protein AN6045.2 [Aspe... 32 2.8
gi|45532607|ref|ZP_00183609.1| COG2217: Cation transport ATPase ... 32 2.8
gi|16080403|ref|NP_391230.1| yvgX [Bacillus subtilis subsp. subt... 32 2.8
gi|20664170|pdb|1KQK|A Chain A, Solution Structure Of The N-Term... 32 2.8
gi|20663964|pdb|1JWW|A Chain A, Nmr Characterization Of The N-Te... 32 2.8
gi|40889292|pdb|1P6T|A Chain A, Structure Characterization Of Th... 32 2.8
gi|19746247|ref|NP_607383.1| phage protein [Streptococcus pyogen... 32 3.7
gi|50795228|ref|XP_423757.1| PREDICTED: similar to RNA binding m... 32 3.7
gi|16763735|ref|NP_459350.1| putative copper chaperone [Salmonel... 32 3.7
gi|22331770|ref|NP_190921.2| heavy-metal-associated domain-conta... 32 4.8
gi|21284207|ref|NP_647295.1| copper-transporting ATPase copA [St... 32 4.8
gi|49484758|ref|YP_041982.1| putative copper importing ATPase A ... 32 4.8
gi|15925547|ref|NP_373081.1| copper-transporting ATPase [Staphyl... 32 4.8
gi|48787194|ref|ZP_00283276.1| COG2608: Copper chaperone [Burkho... 32 4.8
gi|28897532|ref|NP_797137.1| cation transport ATPase, E1-E2 fami... 32 4.8
gi|11280705|pir||T45893 hypothetical protein F4P12.230 - Arabido... 32 4.8
gi|41327148|emb|CAF20992.1| Cation transport ATPase [Corynebacte... 32 4.8
gi|46322825|ref|ZP_00223192.1| COG2217: Cation transport ATPase ... 32 4.8
gi|9501785|dbj|BAB03335.1| hypothetical protein [Staphylococcus ... 32 4.8
gi|29376605|ref|NP_815759.1| tail protein [Enterococcus faecalis... 32 4.8
gi|18309537|ref|NP_561471.1| probable copper-transporting ATPase... 31 6.3
gi|50546951|ref|XP_500945.1| hypothetical protein [Yarrowia lipo... 31 6.3
gi|38106258|gb|EAA52589.1| hypothetical protein MG05281.4 [Magna... 31 6.3
gi|11994385|dbj|BAB02344.1| unnamed protein product [Arabidopsis... 31 6.3
gi|23112525|ref|ZP_00097998.1| COG2608: Copper chaperone [Desulf... 31 6.3
gi|38102435|gb|EAA49272.1| hypothetical protein MG00930.4 [Magna... 31 6.3
gi|15233077|ref|NP_188786.1| copper-binding family protein [Arab... 31 6.3
gi|48836122|ref|ZP_00293119.1| COG2217: Cation transport ATPase ... 31 8.2
gi|16550641|dbj|BAB71022.1| unnamed protein product [Homo sapiens] 31 8.2
gi|15613120|ref|NP_241423.1| copper-transporting ATPase [Bacillu... 31 8.2
gi|46121056|ref|ZP_00201897.1| COG2217: Cation transport ATPase ... 31 8.2
gi|16272245|ref|NP_438457.1| hypothetical protein HI0290 [Haemop... 31 8.2
gi|17865536|sp|O00592|PODX_HUMAN Podocalyxin-like protein 1 prec... 31 8.2
gi|27469038|ref|NP_765675.1| mercuric ion-binding protein [Staph... 31 8.2
gi|37527684|ref|NP_931028.1| Copper-transporting P-type ATPase [... 31 8.2
gi|45915218|ref|ZP_00197010.1| COG2608: Copper chaperone [Mesorh... 31 8.2
gi|33598950|ref|NP_005388.2| podocalyxin-like precursor [Homo sa... 31 8.2
>gi|17557043|ref|NP_498707.1| copper (CU) Chaperonin, functional,
complements yeast atx1 mutant (7.6 kD) (cuc-1)
[Caenorhabditis elegans]
gi|4165309|dbj|BAA37144.1| copper chaperone [Caenorhabditis
elegans]
gi|15487648|gb|AAL00882.1| Cu (copper) chaperonin protein 1
[Caenorhabditis elegans]
Length = 69
Score = 139 bits (349), Expect = 2e-32
Identities = 69/69 (100%), Positives = 69/69 (100%)
Frame = -1
Query: 210 MTQYVFEMGMTCNGCANAARKVLGKLGEDKIKIDDINVETKKITVTTDLPASDVLEALKK 31
MTQYVFEMGMTCNGCANAARKVLGKLGEDKIKIDDINVETKKITVTTDLPASDVLEALKK
Sbjct: 1 MTQYVFEMGMTCNGCANAARKVLGKLGEDKIKIDDINVETKKITVTTDLPASDVLEALKK 60
Query: 30 TGKEIKQLQ 4
TGKEIKQLQ
Sbjct: 61 TGKEIKQLQ 69
>gi|630769|pir||S44900 ZK652.10 protein - Caenorhabditis elegans
Length = 420
Score = 139 bits (349), Expect = 2e-32
Identities = 69/69 (100%), Positives = 69/69 (100%)
Frame = -1
Query: 210 MTQYVFEMGMTCNGCANAARKVLGKLGEDKIKIDDINVETKKITVTTDLPASDVLEALKK 31
MTQYVFEMGMTCNGCANAARKVLGKLGEDKIKIDDINVETKKITVTTDLPASDVLEALKK
Sbjct: 352 MTQYVFEMGMTCNGCANAARKVLGKLGEDKIKIDDINVETKKITVTTDLPASDVLEALKK 411
Query: 30 TGKEIKQLQ 4
TGKEIKQLQ
Sbjct: 412 TGKEIKQLQ 420