Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK742_6
(438 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17562592|ref|NP_505016.1| lipid Binding Protein LBP-4, fatty ... 302 1e-81
gi|39581097|emb|CAE73175.1| Hypothetical protein CBG20572 [Caeno... 288 2e-77
gi|7503066|pir||T16308 hypothetical protein F40F4.4 - Caenorhabd... 218 2e-56
gi|25150208|ref|NP_508556.2| lipid Binding Protein LBP-3, fatty ... 218 2e-56
gi|2494409|sp|Q20222|FAB3_CAEEL Fatty acid-binding protein homol... 218 2e-56
gi|39597707|emb|CAE68398.1| Hypothetical protein CBG14167 [Caeno... 216 6e-56
gi|39597708|emb|CAE68399.1| Hypothetical protein CBG14168 [Caeno... 132 2e-30
gi|2494406|sp|P55776|FABH_ASCSU Fatty acid-binding protein homol... 130 6e-30
gi|38176540|gb|AAG09305.3| embryonic fatty acid-binding protein ... 128 2e-29
gi|17568901|ref|NP_508558.1| lipid Binding Protein LBP-2, fatty ... 127 4e-29
gi|17568899|ref|NP_508557.1| lipid Binding Protein LBP-1, fatty ... 127 4e-29
gi|39597709|emb|CAE68400.1| Hypothetical protein CBG14170 [Caeno... 125 2e-28
gi|18378600|gb|AAL68638.1| cellular retinoic acid/retinol bindin... 59 2e-08
gi|13094950|gb|AAK12095.1| fatty acid binding protein FABP2 [Ech... 56 1e-07
gi|17562594|ref|NP_506440.1| lipid Binding Protein LBP-7, fatty ... 54 7e-07
gi|29336919|sp|Q9BMK3|FAB2_ECHGR Fatty acid-binding protein homo... 53 1e-06
gi|1293786|gb|AAB41297.1| LP2 52 2e-06
gi|27805805|ref|NP_776740.1| fatty acid binding protein 5; epide... 52 3e-06
gi|284718|pir||A42495 retinoic acid-binding protein II, cellular... 52 3e-06
gi|33469075|ref|NP_031785.1| cellular retinoic acid binding prot... 51 4e-06
gi|4389253|pdb|1BM5| The Solution Structure Of A Site-Directed ... 51 6e-06
gi|3318697|pdb|1XCA|A Chain A, Apo-Cellular Retinoic Acid Bindin... 51 6e-06
gi|27531025|dbj|BAC54131.1| fatty acid binding protein [Apis mel... 50 7e-06
gi|4503029|ref|NP_001869.1| cellular retinoic acid binding prote... 50 7e-06
gi|4389255|pdb|1BLR| Nmr Solution Structure Of Human Cellular R... 50 7e-06
gi|999882|pdb|1CBQ| Cellular Retinoic-Acid-Binding Protein Type... 50 7e-06
gi|17508243|ref|NP_491928.1| lipid Binding Protein LBP-5, adipoc... 50 7e-06
gi|47219456|emb|CAG10820.1| unnamed protein product [Tetraodon n... 50 1e-05
gi|33357647|pdb|1O8V|A Chain A, The Crystal Structure Of Echinoc... 50 1e-05
gi|14916990|sp|Q02970|FAB1_ECHGR Fatty acid-binding protein homo... 49 2e-05
gi|12704532|gb|AAK00579.1| fatty acid binding protein [Echinococ... 49 2e-05
gi|14423714|sp|Q9U5P1|FABP_LEPDS Fatty acid-binding protein (All... 49 2e-05
gi|4557581|ref|NP_001435.1| fatty acid binding protein 5 (psoria... 49 3e-05
gi|33771668|gb|AAQ54326.1| cellular retinol-binding protein type... 48 4e-05
gi|39595764|emb|CAE67267.1| Hypothetical protein CBG12714 [Caeno... 48 4e-05
gi|25453404|ref|NP_058940.1| cellular retinoic acid binding prot... 48 4e-05
gi|477303|pir||A48578 fatty acid-binding protein homolog - tapew... 48 5e-05
gi|47216139|emb|CAG10013.1| unnamed protein product [Tetraodon n... 47 6e-05
gi|1710094|sp|P50568|RET3_XENLA Retinoic acid-binding protein, c... 47 6e-05
gi|47221596|emb|CAF97861.1| unnamed protein product [Tetraodon n... 47 6e-05
gi|40217926|gb|AAR82892.1| cellular retinoic acid-binding protei... 47 6e-05
gi|39590475|emb|CAE66215.1| Hypothetical protein CBG11457 [Caeno... 47 6e-05
gi|41202667|ref|XP_370729.1| similar to Fatty acid-binding prote... 47 6e-05
gi|14423698|sp|Q17284|FABP_BLOTA Fatty acid-binding protein (All... 47 8e-05
gi|33504501|ref|NP_878279.1| cellular retinoic acid binding prot... 47 8e-05
gi|1000406|gb|AAB34773.1| xCRABP=cellular retinoic acid binding ... 47 8e-05
gi|13540630|ref|NP_110459.1| brain lipid binding protein; fatty ... 47 1e-04
gi|24645979|ref|NP_731589.1| CG31305-PI [Drosophila melanogaster... 47 1e-04
gi|25013110|gb|AAN71654.1| SD12036p [Drosophila melanogaster] 47 1e-04
gi|48095042|ref|XP_392225.1| similar to fatty acid binding prote... 47 1e-04
gi|47115839|sp|Q8MUC1|FABP_CLOSI Fatty acid-binding protein >gnl... 47 1e-04
gi|10946572|ref|NP_067247.1| fatty acid binding protein 7, brain... 46 1e-04
gi|4505909|ref|NP_002668.1| peripheral myelin protein 2; M-FABP ... 46 1e-04
gi|6093953|sp|O42386|RET3_FUGRU Retinoic acid-binding protein I,... 46 2e-04
gi|8176557|dbj|BAA92241.3| heart fatty acid binding protein [Ang... 45 2e-04
gi|18314500|gb|AAH22069.1| CRABP1 protein [Homo sapiens] 45 2e-04
gi|50752785|ref|XP_413744.1| PREDICTED: similar to Retinoic acid... 45 2e-04
gi|39590474|emb|CAE66214.1| Hypothetical protein CBG11456 [Caeno... 45 2e-04
gi|49903526|gb|AAH76971.1| Unknown (protein for MGC:89469) [Xeno... 45 3e-04
gi|4758052|ref|NP_004369.1| cellular retinoic acid binding prote... 45 3e-04
gi|48146151|emb|CAG33298.1| CRABP1 [Homo sapiens] 45 3e-04
gi|47225916|emb|CAF98396.1| unnamed protein product [Tetraodon n... 45 3e-04
gi|13991622|gb|AAK51437.1| fatty acid binding protein [Echinococ... 45 3e-04
gi|127727|sp|P02691|MYP2_RABIT Myelin P2 protein >gnl|BL_ORD_ID|... 45 4e-04
gi|30794346|ref|NP_851371.1| cellular retinoic acid binding prot... 45 4e-04
gi|38089194|ref|XP_194404.2| similar to keratinocyate lipid-bind... 45 4e-04
gi|47550907|ref|NP_999972.1| fatty acid binding protein 7, brain... 44 5e-04
gi|33504499|ref|NP_878278.1| cellular retinoic acid binding prot... 44 5e-04
gi|17508245|ref|NP_491926.1| lipid Binding Protein LBP-6, adipoc... 44 5e-04
gi|7304975|ref|NP_038524.1| cellular retinoic acid binding prote... 44 5e-04
gi|1421291|pdb|1CBI|A Chain A, Apo-Cellular Retinoic Acid Bindin... 44 5e-04
gi|999883|pdb|1CBR|A Chain A, Cellular Retinoic-Acid-Binding Pro... 44 5e-04
gi|127724|sp|P02690|MYP2_BOVIN Myelin P2 protein >gnl|BL_ORD_ID|... 44 5e-04
gi|12644097|sp|P02694|RET1_BOVIN Retinol-binding protein I, cell... 44 7e-04
gi|15072477|gb|AAK61550.1| heart-type fatty acid-binding protein... 44 9e-04
gi|18858657|ref|NP_571680.1| fatty acid binding protein 7, brain... 44 9e-04
gi|7441536|pir||S69360 retinol-binding protein CRBP, cellular - ... 44 9e-04
gi|23308625|ref|NP_694493.1| fatty acid binding protein 3, muscl... 44 9e-04
gi|27805811|ref|NP_776739.1| fatty acid-binding protein, adipocy... 43 0.001
gi|24645977|ref|NP_731588.1| CG31305-PJ [Drosophila melanogaster... 43 0.001
gi|41152482|ref|NP_955822.1| Unknown (protein for MGC:73335) [Da... 43 0.001
gi|4557585|ref|NP_001437.1| fatty acid binding protein 7, brain;... 43 0.002
gi|48146231|emb|CAG33338.1| FABP7 [Homo sapiens] 43 0.002
gi|1079391|pir||A61629 retinoic acid-binding protein, cellular I... 43 0.002
gi|14423692|sp|O76821|FABP_ACASI Fatty acid-binding protein (All... 43 0.002
gi|4506451|ref|NP_002890.1| retinol binding protein 1, cellular;... 43 0.002
gi|15826067|pdb|1FDQ|A Chain A, Crystal Structure Of Human Brain... 43 0.002
gi|24987402|pdb|1JJX|A Chain A, Solution Structure Of Recombinan... 43 0.002
gi|12224842|emb|CAC21646.1| hypothetical protein [Homo sapiens] 43 0.002
gi|50759293|ref|XP_417606.1| PREDICTED: similar to retinol bindi... 42 0.002
gi|28864170|gb|AAO48275.1| cellular retinoic acid binding protei... 42 0.002
gi|38112691|gb|AAR11382.1| retinoic acid-binding protein I [Hipp... 42 0.002
gi|6754450|ref|NP_034764.1| fatty acid binding protein 5, epider... 42 0.002
gi|47229947|emb|CAG10361.1| unnamed protein product [Tetraodon n... 42 0.003
gi|17565602|ref|NP_503562.1| adipocyte P2 (5C547) [Caenorhabditi... 42 0.003
gi|345327|pir||S29600 fatty acid-binding protein - tapeworm (Ech... 42 0.003
gi|1836058|gb|AAB46848.1| DA11 [Rattus sp.] 42 0.003
gi|33356927|pdb|1G74|A Chain A, Toward Changing Specificity: Adi... 42 0.003
gi|47209311|emb|CAF90734.1| unnamed protein product [Tetraodon n... 42 0.003
gi|39589558|emb|CAE66793.1| Hypothetical protein CBG12153 [Caeno... 42 0.003
gi|50731652|ref|XP_418308.1| PREDICTED: similar to Fatty acid-bi... 42 0.003
gi|6755300|ref|NP_035384.1| retinol binding protein 1, cellular ... 42 0.003
gi|6015123|sp|Q09139|FABB_BOVIN Fatty acid-binding protein, brai... 42 0.003
gi|1706754|sp|P55053|FABE_RAT Fatty acid-binding protein, epider... 41 0.004
gi|22024394|ref|NP_665885.1| fatty acid binding protein 5, epide... 41 0.004
gi|227994|prf||1714345A fatty acid-binding protein 41 0.006
gi|494781|pdb|2HMB| Fatty Acid Binding Protein (Holo Form, Huma... 41 0.006
gi|2605596|dbj|BAA23324.1| fatty acid binding protein [Homo sapi... 41 0.006
gi|50731654|ref|XP_418309.1| PREDICTED: similar to Myelin P2 pro... 41 0.006
gi|30584517|gb|AAP36511.1| Homo sapiens fatty acid binding prote... 41 0.006
gi|49227631|ref|NP_001001842.1| cellular retinoic acid binding p... 41 0.006
gi|1869803|emb|CAA71305.1| mammary-derived growth inhibitor [Hom... 41 0.006
gi|4758328|ref|NP_004093.1| fatty acid binding protein 3; Fatty ... 41 0.006
gi|31226906|ref|XP_317790.1| ENSANGP00000001101 [Anopheles gambi... 41 0.006
gi|31210523|ref|XP_314228.1| ENSANGP00000000937 [Anopheles gambi... 41 0.006
gi|6981464|ref|NP_036865.1| retinol binding protein 1; Retinol-b... 40 0.008
gi|39595763|emb|CAE67266.1| Hypothetical protein CBG12713 [Caeno... 40 0.008
gi|387504|gb|AAA39870.1| adipocyte P2 40 0.010
gi|34484383|gb|AAQ72814.1| cellular retinoic acid binding protei... 40 0.010
gi|11968156|ref|NP_071303.1| retinol binding protein 7, cellular... 40 0.010
gi|809309|pdb|1CRB| Cellular Retinol Binding Protein (Crbp) Com... 40 0.010
gi|50752060|ref|XP_422635.1| PREDICTED: similar to Retinol-bindi... 40 0.010
gi|21730361|pdb|1JBH|A Chain A, Solution Structure Of Cellular R... 40 0.010
gi|47221568|emb|CAF97833.1| unnamed protein product [Tetraodon n... 40 0.010
gi|34783929|gb|AAH56855.1| MGC64521 protein [Xenopus laevis] 40 0.010
gi|3115357|gb|AAC24317.1| cellular retinoic acid binding protein... 40 0.013
gi|127726|sp|P24526|MYP2_MOUSE Myelin P2 protein >gnl|BL_ORD_ID|... 40 0.013
gi|4557579|ref|NP_001433.1| fatty acid binding protein 4, adipoc... 40 0.013
gi|3123260|sp|P40220|RET3_CHICK Retinoic acid-binding protein I,... 40 0.013
gi|30584397|gb|AAP36447.1| Homo sapiens fatty acid binding prote... 40 0.013
gi|47933560|gb|AAT39384.1| fatty acid binding protein 15 [Schist... 40 0.013
gi|14423683|sp|O97788|FABA_PIG Fatty acid-binding protein, adipo... 39 0.017
gi|20138310|sp|Q99P60|FABA_SPETR Fatty acid-binding protein, adi... 39 0.017
gi|34810952|pdb|1MX7|A Chain A, Two Homologous Rat Cellular Reti... 39 0.022
gi|38541378|gb|AAH61929.1| MGC68491 protein [Xenopus laevis] 39 0.022
gi|48479258|gb|AAT44900.1| hypothetical protein [Branchiostoma b... 39 0.022
gi|4826720|ref|NP_000125.1| intestinal fatty acid binding protei... 39 0.029
gi|42658985|ref|XP_378035.1| similar to fatty acid binding prote... 39 0.029
gi|1169596|sp|P41496|FABM_SCHGR Fatty acid-binding protein, musc... 39 0.029
gi|1169595|sp|P41509|FABM_LOCMI Fatty acid-binding protein, musc... 39 0.029
gi|20270936|gb|AAM18481.1| Sm14 fatty acid-binding protein delta... 39 0.029
gi|7546449|pdb|1DC9|A Chain A, Properties And Crystal Structure ... 39 0.029
gi|6730031|pdb|3IFB|A Chain A, Nmr Study Of Human Intestinal Fat... 39 0.029
gi|33357254|pdb|1KZW|A Chain A, Solution Structure Of Human Inte... 39 0.029
gi|33357255|pdb|1KZX|A Chain A, Solution Structure Of Human Inte... 39 0.029
gi|232082|sp|P29498|FABP_SCHMA 14 kDa fatty acid-binding protein... 39 0.029
gi|2738182|gb|AAC60356.1| fatty acid binding protein H8-isoform ... 39 0.029
gi|2738188|gb|AAC60359.1| fatty acid binding protein H8-isoform ... 39 0.029
gi|2738184|gb|AAC60357.1| fatty acid binding protein H8-isoform ... 39 0.029
gi|348407|pir||A44870 fatty acid-binding protein, flight muscle ... 39 0.029
gi|6679737|ref|NP_032006.1| fatty acid binding protein 2, intest... 38 0.038
gi|34854980|ref|XP_342215.1| similar to myelin P2 protein - mous... 38 0.038
gi|6978827|ref|NP_037200.1| fatty acid binding protein 1; Fatty ... 38 0.038
gi|90268|pir||B25952 myelin P2 protein homolog - mouse >gnl|BL_O... 38 0.038
gi|14149635|ref|NP_077717.1| fatty acid binding protein 4, adipo... 38 0.038
gi|24474489|emb|CAA37738.2| cellular retinoic-acid-binding prote... 38 0.038
gi|104855|pir||S13796 retinoic acid-binding protein, cellular - ... 38 0.038
gi|2738186|gb|AAC60358.1| fatty acid binding protein H8-isoform ... 38 0.038
gi|442633|pdb|1ALB| Adipocyte Lipid-Binding Protein >gnl|BL_ORD... 38 0.038
gi|494202|pdb|1ICN| Intestinal Fatty Acid Binding Protein Mutan... 38 0.038
gi|49257292|gb|AAH72965.1| Unknown (protein for MGC:82505) [Xeno... 38 0.038
gi|3318748|pdb|1A18| Phenanthroline Modified Murine Adipocyte L... 38 0.038
gi|230028|pdb|1IFB| Intestinal Fatty Acid Binding Protein (Apo ... 38 0.038
gi|2494403|sp|Q91775|FABI_XENLA Fatty acid-binding protein, inte... 38 0.049
gi|6007485|gb|AAF00925.1| intestinal fatty acid binding protein ... 38 0.049
gi|38076194|ref|XP_357279.1| similar to myelin P2 protein - mous... 38 0.049
gi|16418455|ref|NP_443192.1| retinol binding protein 7, cellular... 38 0.049
gi|47115579|sp|O45035|FABP_SCHJA Fatty acid-binding protein (Sj-... 37 0.064
gi|45383556|ref|NP_989621.1| fatty acid binding protein 4, adipo... 37 0.064
gi|30144595|gb|AAP14670.1| cytoplasmic fatty acid binding protei... 37 0.064
gi|13242739|gb|AAB32592.2| myelin P2 protein [Homo sapiens] 37 0.064
gi|2392054|pdb|1ACD| V32dF57H MUTANT OF MURINE ADIPOCYTE LIPID ... 37 0.064
gi|2392041|pdb|1AB0| C1gV32DF57H MUTANT OF MURINE ADIPOCYTE LIP... 37 0.064
gi|20270934|gb|AAM18480.1| Sm14 fatty acid-binding protein isofo... 37 0.064
gi|28373546|pdb|1LPJ|A Chain A, Human Crbp Iv 37 0.064
gi|27464844|gb|AAO16213.1| intestinal fatty acid-binding protein... 37 0.084
gi|47230706|emb|CAF99899.1| unnamed protein product [Tetraodon n... 37 0.084
gi|40804425|gb|AAR91708.1| muscle fatty acid binding protein [Sa... 37 0.084
gi|30144605|gb|AAP14675.1| cytoplasmic fatty acid binding protei... 37 0.11
gi|12247841|gb|AAG50052.1| fatty acid-binding protein [Schistoso... 37 0.11
gi|30144597|gb|AAP14671.1| cytoplasmic fatty acid binding protei... 37 0.11
gi|45384320|ref|NP_990639.1| cl. 453 fatty acid or lipid binding... 37 0.11
gi|30144599|gb|AAP14672.1| cytoplasmic fatty acid binding protei... 37 0.11
gi|30144601|gb|AAP14673.1| cytoplasmic fatty acid binding protei... 37 0.11
gi|349804|gb|AAA64426.1| fatty acid binding protein 37 0.11
gi|38075668|ref|XP_357251.1| similar to Fatty acid-binding prote... 36 0.14
gi|2811080|sp|O13008|FABH_ONCMY Fatty acid-binding protein, hear... 36 0.14
gi|46249534|gb|AAH68742.1| MGC81232 protein [Xenopus laevis] 36 0.19
gi|47116941|sp|Q9U1G6|FAB3_FASHE Fatty acid-binding protein type... 35 0.25
gi|41350900|gb|AAH65787.1| Unknown (protein for MGC:73634) [Mus ... 35 0.25
gi|204072|gb|AAA41133.1| fatty acid binding protein 35 0.25
gi|49618768|gb|AAT67999.1| fatty acid-binding protein [Gallus ga... 35 0.25
gi|34854891|ref|XP_346620.1| hypothetical protein XP_346619 [Rat... 35 0.32
gi|2494405|sp|P70623|FABA_RAT Fatty acid-binding protein, adipoc... 35 0.32
gi|32450317|gb|AAH53830.1| Unknown (protein for IMAGE:6873358) [... 35 0.32
gi|7387652|sp|P82289|FABL_LEPPA Fatty acid-binding protein, live... 35 0.32
gi|17562596|ref|NP_506444.1| predicted CDS, lipid Binding Protei... 35 0.32
gi|16758094|ref|NP_445817.1| fatty acid binding protein 4; fatty... 35 0.32
gi|48140594|ref|XP_393519.1| similar to Fatty acid-binding prote... 35 0.32
gi|119807|sp|P80049|FABL_GINCI Fatty acid-binding protein, liver... 35 0.42
gi|44888806|sp|P80226|FABL_CHICK Fatty acid-binding protein, liv... 35 0.42
gi|28948672|pdb|1MVG|A Chain A, Nmr Solution Structure Of Chicke... 35 0.42
gi|38111791|gb|EAA57308.1| predicted protein [Magnaporthe grisea... 34 0.55
gi|49532918|dbj|BAD26694.1| cellular retinoic acid binding prote... 34 0.55
gi|204082|gb|AAA41138.1| intestinal FABP 34 0.55
gi|47228810|emb|CAG07542.1| unnamed protein product [Tetraodon n... 34 0.55
gi|4887137|gb|AAD32209.1| adipocyte lipid-binding protein [Oryct... 34 0.55
gi|8393346|ref|NP_058794.1| fatty acid binding protein 6; Fatty ... 34 0.71
gi|48526346|gb|AAT45378.1| fatty acid-binding protein homolog 3 ... 34 0.71
gi|4033695|sp|P80020|ILBP_RAT Gastrotropin (GT) (Ileal lipid-bin... 34 0.71
gi|31982061|ref|NP_033060.2| retinol binding protein 2, cellular... 34 0.71
gi|3287845|sp|P81399|FAB1_AMBME Fatty acid-binding protein 1, li... 33 0.93
gi|730494|sp|Q08652|RET2_MOUSE Retinol-binding protein II, cellu... 33 0.93
gi|37549395|ref|XP_293018.2| similar to Fatty acid-binding prote... 33 0.93
gi|12408304|ref|NP_074045.1| testis lipid binding protein [Rattu... 33 1.2
gi|2811070|sp|O08716|TLBP_MOUSE Testis lipid binding protein (TL... 33 1.2
gi|6680441|ref|NP_032401.1| fatty acid binding protein 6, ileal ... 33 1.2
gi|45382869|ref|NP_989965.1| liver basic fatty acid binding prot... 33 1.2
gi|20454197|gb|AAM22208.1| fatty acid binding protein [Epinephel... 33 1.2
gi|47222259|emb|CAG11138.1| unnamed protein product [Tetraodon n... 33 1.2
gi|6981466|ref|NP_036772.1| retinol-binding protein 2; Retinol-b... 33 1.2
gi|11132085|sp|O42494|FABP_FUGRU Fatty acid-binding protein >gnl... 33 1.2
gi|34854808|ref|XP_231258.2| similar to Fatty acid-binding prote... 33 1.2
gi|50746737|ref|XP_420632.1| PREDICTED: similar to intestinal fa... 33 1.6
gi|40254574|ref|NP_035728.2| fatty acid binding protein 9, testi... 33 1.6
gi|16974775|gb|AAL32464.1| fatty acid-binding protein [Anas plat... 33 1.6
gi|7993938|sp|P82188|FABL_LAMJA Fatty acid-binding protein, live... 33 1.6
gi|48142802|ref|XP_397375.1| similar to CG9432-PB [Apis mellifera] 33 1.6
gi|15612542|ref|NP_224195.1| putative [Helicobacter pylori J99] ... 32 2.1
gi|132399|sp|P06768|RET2_RAT Retinol-binding protein II, cellula... 32 2.1
gi|23821536|sp|P83409|FABL_BUFAR Fatty acid-binding protein, liv... 32 2.1
gi|443161|pdb|1OPA|A Chain A, Cellular Retinol Binding Protein I... 32 2.1
gi|18490679|gb|AAH22489.1| FABP6 protein [Homo sapiens] 32 2.7
gi|38090040|ref|XP_357967.1| similar to Retinol-binding protein ... 32 2.7
gi|182356|gb|AAA52418.1| fatty acid binding protein 32 2.7
gi|4557577|ref|NP_001434.1| fatty acid binding protein 1, liver;... 32 2.7
gi|6015125|sp|P81653|FABL_HALBI Fatty acid-binding protein, live... 32 2.7
gi|47086249|ref|NP_998060.1| cellular retinol-binding protein ty... 32 2.7
gi|2738180|gb|AAC60355.1| fatty acid binding protein H6-isoform ... 32 3.5
gi|2738178|gb|AAC60354.1| fatty acid binding protein H6-isoform ... 32 3.5
gi|2738170|gb|AAC60350.1| fatty acid binding protein H6-isoform ... 32 3.5
gi|2738174|gb|AAC60352.1| fatty acid binding protein H6-isoform ... 32 3.5
gi|23308627|ref|NP_694492.1| fatty acid binding protein 10, live... 32 3.5
gi|11095781|gb|AAG30019.1| fatty acid binding protein [Oncorhync... 32 3.5
gi|181033|gb|AAA35714.1| retinol-binding protein 32 3.5
gi|24586058|ref|NP_724492.1| CG9432-PB [Drosophila melanogaster]... 32 3.5
gi|6984068|gb|AAF34748.1| l(2)01289 long form [Drosophila melano... 32 3.5
gi|4557583|ref|NP_001436.1| gastrotropin; I-BAP; illeal lipid-bi... 31 4.6
gi|1706761|sp|P49924|FABL_PIG Fatty acid-binding protein, liver ... 31 4.6
gi|47200506|emb|CAF89192.1| unnamed protein product [Tetraodon n... 31 4.6
gi|28949055|pdb|1O1U|A Chain A, Human Ileal Lipid-Binding Protei... 31 4.6
gi|191493|gb|AAA37112.1| 13K protein 31 4.6
gi|38106508|gb|EAA52802.1| hypothetical protein MG05930.4 [Magna... 31 6.0
gi|50304705|ref|XP_452308.1| unnamed protein product [Kluyveromy... 31 6.0
gi|15646176|ref|NP_208360.1| hypothetical protein HP1569 [Helico... 31 6.0
gi|42662592|ref|XP_377031.1| similar to nuclear RNA export facto... 31 6.0
gi|2833285|sp|Q17017|FABP_ANOGA Probable fatty acid binding prot... 31 6.0
gi|50417068|gb|AAH77102.1| Unknown (protein for MGC:100825) [Dan... 31 6.0
gi|92724|pir||A03150 retinoic acid-binding protein, cellular - r... 31 6.0
gi|266905|sp|P30370|RET4_CHICK Retinoic acid-binding protein II,... 31 6.0
gi|3122083|sp|P80856|FABL_RHASA Fatty acid-binding protein, live... 31 6.0
gi|23308503|ref|NP_694549.1| retinol binding protein 2, cellular... 31 6.0
gi|23483552|gb|EAA19186.1| mature parasite-infected erythrocyte ... 31 6.0
gi|15487668|ref|NP_149345.1| nuclear RNA export factor 5 isoform... 30 7.9
gi|15487660|ref|NP_116564.1| nuclear RNA export factor 5 isoform... 30 7.9
gi|13430854|ref|NP_071336.1| nuclear RNA export factor 2; TAP li... 30 7.9
gi|15487666|ref|NP_149344.1| nuclear RNA export factor 5 isoform... 30 7.9
gi|34907340|ref|NP_915017.1| P0471B04.4 [Oryza sativa (japonica ... 30 7.9
gi|23508880|ref|NP_701548.1| hypothetical protein [Plasmodium fa... 30 7.9
gi|24379598|ref|NP_721553.1| putative transcriptional regulator ... 30 7.9
gi|47479834|gb|AAH69469.1| Unknown (protein for IMAGE:7262743) [... 30 7.9
gi|40354214|ref|NP_004155.2| retinol binding protein 2, cellular... 30 7.9
gi|23200278|pdb|1KQW|A Chain A, Crystal Structure Of Holo-Crbp F... 30 7.9
gi|13603875|gb|AAK31975.1| nuclear export factor 2 [Homo sapiens] 30 7.9
gi|2392417|pdb|1LFO| Liver Fatty Acid Binding Protein - Oleate ... 30 7.9
gi|38110788|gb|EAA56455.1| hypothetical protein MG06426.4 [Magna... 30 7.9
gi|31231525|ref|XP_318541.1| ENSANGP00000019609 [Anopheles gambi... 30 7.9
gi|27468746|ref|NP_765383.1| DNA topoisomerase III topB [Staphyl... 30 7.9
gi|15487662|ref|NP_149342.1| nuclear RNA export factor 5 isoform... 30 7.9
gi|11359915|pir||T46922 hypothetical protein DKFZp434B1612.1 - h... 30 7.9
gi|12045227|ref|NP_073038.1| conserved hypothetical protein [Myc... 30 7.9
gi|7020501|dbj|BAA91154.1| unnamed protein product [Homo sapiens] 30 7.9
gi|50305155|ref|XP_452536.1| unnamed protein product [Kluyveromy... 30 7.9
>gi|17562592|ref|NP_505016.1| lipid Binding Protein LBP-4, fatty
acid-binding protein homolog 3 like (17.2 kD) (lbp-4)
[Caenorhabditis elegans]
gi|2494410|sp|Q23092|FAB4_CAEEL Fatty acid-binding protein homolog
4
gi|25396546|pir||B89114 protein ZK742.5 [imported] - Caenorhabditis
elegans
gi|1465821|gb|AAB04984.1| Lipid binding protein protein 4
[Caenorhabditis elegans]
Length = 145
Score = 302 bits (773), Expect = 1e-81
Identities = 145/145 (100%), Positives = 145/145 (100%)
Frame = +1
Query: 1 MSVPDKFFGRYQLDKSENFDEFLSSKGVNWFVRQMIKLAGLTKIISQNQEAGKYNMENLT 180
MSVPDKFFGRYQLDKSENFDEFLSSKGVNWFVRQMIKLAGLTKIISQNQEAGKYNMENLT
Sbjct: 1 MSVPDKFFGRYQLDKSENFDEFLSSKGVNWFVRQMIKLAGLTKIISQNQEAGKYNMENLT 60
Query: 181 SKKNTNYQAWELGKKFEAPGLDGNQHEITFDFKDEILSEHHIRLNEPETSAETYFYTIDD 360
SKKNTNYQAWELGKKFEAPGLDGNQHEITFDFKDEILSEHHIRLNEPETSAETYFYTIDD
Sbjct: 61 SKKNTNYQAWELGKKFEAPGLDGNQHEITFDFKDEILSEHHIRLNEPETSAETYFYTIDD 120
Query: 361 QNQLVMRMENNGIVCRRWFKRVEQK 435
QNQLVMRMENNGIVCRRWFKRVEQK
Sbjct: 121 QNQLVMRMENNGIVCRRWFKRVEQK 145