Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK792_7
(555 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|126498|sp|P22981|LT60_CAEEL Ras protein let-60 >gnl|BL_ORD_ID... 348 4e-95
gi|32565695|ref|NP_502213.2| RAS protein, LEThal LET-60, abnorma... 348 4e-95
gi|39593776|emb|CAE62069.1| Hypothetical protein CBG06092 [Caeno... 346 2e-94
gi|280689|pir||A37355 transforming protein (ras) - African clawe... 280 1e-74
gi|22203744|ref|NP_067259.2| c-K-ras2 protein [Mus musculus] >gn... 277 1e-73
gi|13928698|ref|NP_113703.1| c-K-ras2 protein; c-Kirsten-ras pro... 276 1e-73
gi|939930|emb|CAA80675.1| proto-oncogene protein [Kirsten murine... 276 1e-73
gi|6919953|sp|Q9YH38|RASK_CYPCA Transforming protein p21 (K-Ras)... 276 2e-73
gi|15718761|ref|NP_004976.2| c-K-ras2 protein isoform b; Kirsten... 276 2e-73
gi|1674499|gb|AAB19064.1| RAS-protein [Pristionchus pacificus] 276 2e-73
gi|50729116|ref|XP_416436.1| PREDICTED: similar to turkey K-Ras ... 275 3e-73
gi|186764|gb|AAB41942.1| K-ras oncogene protein [Homo sapiens] 275 3e-73
gi|422713|pir||S31720 transforming protein (K-ras) - short-taile... 275 3e-73
gi|3097256|emb|CAA76678.1| p21-ras protein [Platichthys flesus] 275 3e-73
gi|420621|pir||S34138 transforming protein (K-ras) - Kirsten mur... 274 7e-73
gi|15488883|gb|AAH13572.1| C-K-ras2 protein, isoform b [Homo sap... 274 9e-73
gi|30585231|gb|AAP36888.1| Homo sapiens v-Ki-ras2 Kirsten rat sa... 274 9e-73
gi|19070091|emb|CAD24769.1| small G protein [Oscheius tipulae] 273 1e-72
gi|1172842|sp|Q07983|RASK_MONDO Transforming protein p21 (K-Ras)... 273 2e-72
gi|6919952|sp|O42277|RASK_ORYLA Transforming protein p21/K-ras-1... 272 3e-72
gi|464552|sp|Q05147|RASK_XENLA Transforming protein p21 (K-Ras) ... 272 3e-72
gi|3290012|gb|AAC25633.1| GTPase K-rasB [Parophrys vetula] 271 4e-72
gi|31198035|ref|XP_307965.1| ENSANGP00000013477 [Anopheles gambi... 271 6e-72
gi|17136430|ref|NP_476699.1| CG9375-PA [Drosophila melanogaster]... 271 7e-72
gi|41053758|ref|NP_956552.1| similar to Kirsten rat sarcoma onco... 269 2e-71
gi|6572473|gb|AAF17287.1| G-protein [Oncorhynchus mykiss] 269 2e-71
gi|6572471|gb|AAF17286.1| G-protein [Oncorhynchus mykiss] 269 2e-71
gi|13173395|gb|AAK14389.1| Ras [Marsupenaeus japonicus] 269 3e-71
gi|225550|prf||1306284A gene Dmras85D 269 3e-71
gi|18031734|gb|AAK64517.1| small G-protein H-Ras [Xenopus laevis] 268 4e-71
gi|627253|pir||A54321 transforming protein c-Ki-ras-1, hepatic -... 268 5e-71
gi|47217082|emb|CAG02393.1| unnamed protein product [Tetraodon n... 267 8e-71
gi|280937|pir||A43816 transforming protein ras - rabbit 266 1e-70
gi|38303987|gb|AAH61885.1| Unknown (protein for IMAGE:6311846) [... 266 2e-70
gi|3599487|gb|AAC35360.1| Ras protein [Xenopus laevis] 266 2e-70
gi|208115|gb|AAA72806.1| p21 protein >gnl|BL_ORD_ID|1323920 gi|2... 266 2e-70
gi|4885425|ref|NP_005334.1| v-Ha-ras Harvey rat sarcoma viral on... 266 2e-70
gi|131872|sp|P23175|RASH_MSVNS Transforming protein p21 >gnl|BL_... 266 2e-70
gi|131873|sp|P20171|RASH_RAT Transforming protein p21/H-Ras-1 (c... 265 3e-70
gi|3097258|emb|CAA76679.1| p21-ras protein [Platichthys flesus] 265 4e-70
gi|14595123|dbj|BAB61869.1| Rai-chu 101 [synthetic construct] 265 4e-70
gi|14595125|dbj|BAB61870.1| Rai-chu 101X [synthetic construct] 265 4e-70
gi|46048705|ref|NP_990623.1| v-Ha-ras Harvey rat sarcoma viral o... 265 4e-70
gi|230266|pdb|1Q21| c-H-Ras p21 Protein Catalytic Domain Comple... 265 5e-70
gi|230680|pdb|2Q21| c-H-Ras p21 Protein Catalytic Domain (Mutan... 265 5e-70
gi|131870|sp|P01113|RASH_MSV Transforming protein p21 >gnl|BL_OR... 265 5e-70
gi|61559|emb|CAA25322.1| transforming protein p21 [Murine sarcom... 264 7e-70
gi|243893|gb|AAB21190.1| K-rev-1=transformation-suppressor [mice... 264 9e-70
gi|131871|sp|P01115|RASH_MSVHA Transforming protein p29 [Contain... 264 9e-70
gi|6680271|ref|NP_032310.1| Harvey rat sarcoma virus oncogene 1 ... 264 9e-70
gi|332189|gb|AAA46570.1| p21 v-has transforming protein 264 9e-70
gi|50760413|ref|XP_418011.1| PREDICTED: similar to GTP-binding p... 264 9e-70
gi|417590|sp|P32883|RASK_MOUSE Transforming protein p21 (K-Ras 2... 263 1e-69
gi|3334309|sp|Q91806|RASN_XENLA Ras-related protein N-Ras >gnl|B... 263 1e-69
gi|515076|pdb|1AGP| C-H-Ras P21 Protein Mutant With Gly 12 Repl... 263 2e-69
gi|231162|pdb|5P21| c-H-Ras p21 Protein (Amino Acids 1 - 166) C... 263 2e-69
gi|494886|pdb|421P| H-Ras P21 Protein Mutant With Gly 12 Replac... 263 2e-69
gi|5107686|pdb|1RVD|A Chain A, H-Ras Complexed With Diaminobenzo... 263 2e-69
gi|131874|sp|P01114|RASH_RRASV Transforming protein p29 [Contain... 263 2e-69
gi|4505451|ref|NP_002515.1| neuroblastoma RAS viral (v-ras) onco... 263 2e-69
gi|12847999|dbj|BAB27790.1| unnamed protein product [Mus musculu... 263 2e-69
gi|18158431|ref|NP_542944.1| neuroblastoma RAS viral (v-ras) onc... 263 2e-69
gi|15082146|gb|AAK84038.1| N-ras [Monodelphis domestica] 263 2e-69
gi|131882|sp|P12825|RASN_CAVPO Transforming protein N-Ras >gnl|B... 263 2e-69
gi|7242162|ref|NP_035067.1| neuroblastoma ras oncogene [Mus musc... 263 2e-69
gi|48094861|ref|XP_394288.1| similar to ENSANGP00000013477 [Apis... 263 2e-69
gi|494936|pdb|821P| C-H-Ras P21 Protein (Residues 1 - 166) Muta... 263 2e-69
gi|131884|sp|P08556|RASN_MOUSE Transforming protein N-Ras >gnl|B... 263 2e-69
gi|50724567|emb|CAH05038.1| ras GTPase [Echinococcus multilocula... 262 3e-69
gi|576243|pdb|1PLK| C-H-Ras P21 Protein Mutant With Gly 12 Repl... 262 3e-69
gi|4930054|pdb|1LFD|B Chain B, Crystal Structure Of The Active R... 262 3e-69
gi|15718763|ref|NP_203524.1| c-K-ras2 protein isoform a; Kirsten... 262 3e-69
gi|494721|pdb|221P| H-Ras P21 Protein Mutant With Asp 38 Replac... 261 4e-69
gi|494910|pdb|521P| H-Ras P21 Protein Mutant With Gly 12 Replac... 261 4e-69
gi|24987567|pdb|1LF0|A Chain A, Crystal Structure Of Rasa59g In ... 261 4e-69
gi|14488521|pdb|1IAQ|A Chain A, C-H-Ras P21 Protein Mutant With ... 261 4e-69
gi|2072749|emb|CAA73253.1| proto-oncogene K-Ras2A [Xenopus laevis] 261 4e-69
gi|494922|pdb|621P| H-Ras P21 Protein Mutant With Gln 61 Replac... 261 6e-69
gi|131886|sp|P05774|RAS_CARAU Ras-like protein >gnl|BL_ORD_ID|15... 261 8e-69
gi|494925|pdb|721P| H-Ras P21 Protein Mutant With Gln 61 Replac... 260 1e-68
gi|34881271|ref|XP_346330.1| similar to Transforming protein p21... 260 1e-68
gi|47219806|emb|CAG03433.1| unnamed protein product [Tetraodon n... 260 1e-68
gi|131877|sp|P01117|RASK_MSVKI Transforming protein p21 (K-Ras) ... 260 1e-68
gi|49904671|gb|AAH76419.1| Unknown (protein for MGC:100761) [Dan... 259 2e-68
gi|29726772|pdb|1NVV|Q Chain Q, Structural Evidence For Feedback... 259 2e-68
gi|422506|pir||S35097 transforming protein (D-ras-1) - fruit fly... 259 2e-68
gi|226746|prf||1604384A ras oncogene 259 2e-68
gi|223752|prf||0909261A protein Calu1 Ki-ras 259 3e-68
gi|1093939|prf||2105181A c-Ki-ras protooncogene 258 4e-68
gi|2815620|gb|AAB97888.1| c-Ki-ras-2 protooncogene [Oryzias lati... 257 1e-67
gi|18859133|ref|NP_571220.1| N-ras oncogene p21; etID18709.8 [Da... 256 1e-67
gi|131885|sp|P18262|RAS_ARTSA Ras-like protein >gnl|BL_ORD_ID|14... 256 1e-67
gi|1575028|gb|AAB09439.1| Psmras1 [Schistosoma mansoni] 253 2e-66
gi|34222246|ref|NP_789765.1| v-Ha-ras Harvey rat sarcoma viral o... 238 7e-62
gi|29747856|gb|AAH50837.1| Unknown (protein for IMAGE:6509827) [... 235 3e-61
gi|2118466|pir||I80324 PR371 c-K-ras oncogene - human (fragment)... 231 5e-60
gi|2118467|pir||I59431 PR310 c-K-ras oncogene - human (fragment)... 230 1e-59
gi|131862|sp|P15064|RASG_DICDI Ras-like protein rasG >gnl|BL_ORD... 228 7e-59
gi|730475|sp|P03967|RASD_DICDI Ras-like protein rasD (Transformi... 224 6e-58
gi|464547|sp|P34729|RAS1_PHYPO Ras-like protein 1 >gnl|BL_ORD_ID... 221 9e-57
gi|6093896|sp|P51539|RAS1_HYDMA Ras-like protein RAS1 >gnl|BL_OR... 219 2e-56
gi|7438362|pir||JC6328 Ras2 protein - slime mold (Dictyostelium ... 219 3e-56
gi|464548|sp|P34726|RAS2_PHYPO Ras-like protein 2 >gnl|BL_ORD_ID... 219 3e-56
gi|2147995|pir||S58220 transforming protein ras-2 - Dictyosteliu... 218 7e-56
gi|213478|gb|AAA49429.1| ras-1 protein 217 1e-55
gi|227605|prf||1707302A ras oncogene 216 3e-55
gi|1109582|gb|AAA83022.1| RAS gene product 215 5e-55
gi|7768785|gb|AAD56718.2| H-ras [Mus musculus] 214 1e-54
gi|34932861|ref|XP_233322.2| similar to Transforming protein N-R... 213 2e-54
gi|68948|pir||TVDORS transforming protein ras - slime mold (Dict... 213 2e-54
gi|167869|gb|AAA33245.1| ras protein 207 1e-52
gi|1890611|emb|CAA72269.1| Ras protein homologue [Schistosoma ma... 206 2e-52
gi|417588|sp|P32252|RASB_DICDI Ras-like protein rasB >gnl|BL_ORD... 206 3e-52
gi|100997|pir||C36365 transforming protein homolog MRAS3 - Rhizo... 201 7e-51
gi|3929359|sp|O42785|RASL_COLTR Ras-like protein (Ct-Ras) >gnl|B... 201 7e-51
gi|131867|sp|P22280|RAS3_RHIRA Ras-like protein 3 >gnl|BL_ORD_ID... 201 7e-51
gi|13195562|gb|AAK15758.1| ras-like protein [Pisolithus sp. 441] 201 9e-51
gi|46136525|ref|XP_389954.1| RASL_COLTR Ras-like protein [Gibber... 200 1e-50
gi|29467612|dbj|BAC67198.1| ras protein [Fusarium oxysporum] 200 1e-50
gi|131860|sp|P22278|RAS1_RHIRA Ras-like protein 1 >gnl|BL_ORD_ID... 200 2e-50
gi|50424369|ref|XP_460771.1| unnamed protein product [Debaryomyc... 199 2e-50
gi|4150910|emb|CAA77070.1| ras protein [Suberites domuncula] 199 3e-50
gi|464550|sp|Q05058|RASL_COPCI 24 kDa RAS-like protein >gnl|BL_O... 199 4e-50
gi|49084202|ref|XP_404319.1| RAS_EMENI RAS-LIKE PROTEIN [Aspergi... 198 5e-50
gi|6919951|sp|Q12526|RAS_EMENI Ras-like protein >gnl|BL_ORD_ID|3... 198 5e-50
gi|37926420|gb|AAO64439.1| RAS GTPase [Penicillium marneffei] 198 5e-50
gi|49068624|ref|XP_398601.1| RASL_COPCI 24 kDa RAS-like protein ... 198 5e-50
gi|47219673|emb|CAG02718.1| unnamed protein product [Tetraodon n... 198 6e-50
gi|38106759|gb|EAA53026.1| hypothetical protein MG06154.4 [Magna... 198 6e-50
gi|6919949|sp|O93856|RAS_LACBI Ras-like protein >gnl|BL_ORD_ID|1... 197 8e-50
gi|6919950|sp|P87018|RAS_BOTCI Ras-like protein >gnl|BL_ORD_ID|8... 197 8e-50
gi|46435925|gb|EAK95297.1| hypothetical protein CaO19.9329 [Cand... 197 8e-50
gi|825440|gb|AAB07703.1| RAS [Aspergillus fumigatus] >gnl|BL_ORD... 197 1e-49
gi|6103365|gb|AAF03566.1| Ras homolog type A [Candida albicans] 197 1e-49
gi|15214239|sp|Q9UQX7|RAS1_CANAL Ras-like protein 1 (Ras homolog... 197 1e-49
gi|7638417|gb|AAF65465.1| Ras1p [Suillus bovinus] 197 1e-49
gi|131888|sp|P28775|RAS_LENED Ras-like protein >gnl|BL_ORD_ID|67... 196 3e-49
gi|131881|sp|P22126|RAS1_NEUCR Ras-1 protein >gnl|BL_ORD_ID|7298... 195 4e-49
gi|5036|emb|CAA27399.1| put. ras protein [Schizosaccharomyces po... 195 5e-49
gi|19114491|ref|NP_593579.1| ras-like protein 1. [Schizosaccharo... 194 1e-48
gi|50346854|gb|AAT75139.1| ras protein [Sclerotinia sclerotiorum] 193 2e-48
gi|11274531|pir||T45545 transforming protein ras - fission yeast... 191 7e-48
gi|6324675|ref|NP_014744.1| ras proto-oncogene homolog; Ras1p [S... 190 2e-47
gi|172361|gb|AAA34958.1| RAS1 protein 190 2e-47
gi|50285477|ref|XP_445167.1| unnamed protein product [Candida gl... 190 2e-47
gi|10953764|gb|AAG25584.1| RAS protein [Cryptococcus neoformans ... 189 2e-47
gi|68942|pir||TVBYSR transforming protein ras - fission yeast (... 189 2e-47
gi|6919948|sp|O74650|RAS_CRYNE Ras-like protein >gnl|BL_ORD_ID|9... 189 3e-47
gi|5916199|gb|AAD55937.1| RAS1 [Filobasidiella neoformans] 189 4e-47
gi|417589|sp|P32253|RASC_DICDI Ras-like protein rasC >gnl|BL_ORD... 188 5e-47
gi|45187611|ref|NP_983834.1| ADL262Wp [Eremothecium gossypii] >g... 187 1e-46
gi|1617077|emb|CAA25624.1| p21 protein [Homo sapiens] 186 3e-46
gi|4291|emb|CAA25207.1| unnamed protein product [Saccharomyces c... 185 4e-46
gi|172363|gb|AAA34959.1| RAS2 protein 185 4e-46
gi|6324231|ref|NP_014301.1| Ras proto-oncogene homolog. Ras2 is ... 185 4e-46
gi|417591|sp|P32254|RASS_DICDI Ras-like protein rasS >gnl|BL_ORD... 183 2e-45
gi|24657269|ref|NP_523917.2| CG1167-PA [Drosophila melanogaster]... 182 3e-45
gi|49069938|ref|XP_399258.1| hypothetical protein UM01643.1 [Ust... 182 3e-45
gi|223831|prf||1001202A protein c-ras sc1 182 3e-45
gi|31241521|ref|XP_321191.1| ENSANGP00000020068 [Anopheles gambi... 182 5e-45
gi|730474|sp|P38976|RAS2_HYDMA Ras-like protein RAS2 >gnl|BL_ORD... 181 8e-45
gi|17542026|ref|NP_501549.1| vertebrate Rap GTPase homolog, RAS ... 181 8e-45
gi|37682135|gb|AAQ97994.1| RAP1B, member of RAS oncogene family ... 181 1e-44
gi|17136706|ref|NP_476857.1| CG1956-PA [Drosophila melanogaster]... 181 1e-44
gi|47230460|emb|CAF99653.1| unnamed protein product [Tetraodon n... 180 1e-44
gi|47212340|emb|CAF95609.1| unnamed protein product [Tetraodon n... 180 1e-44
gi|48132532|ref|XP_396692.1| similar to ENSANGP00000020068 [Apis... 179 3e-44
gi|68947|pir||TVHUC2 GTP-binding protein RAS/TC21 - human >gnl|B... 179 4e-44
gi|21361416|ref|NP_036382.2| related RAS viral (r-ras) oncogene ... 179 4e-44
gi|26347567|dbj|BAC37432.1| unnamed protein product [Mus musculus] 179 4e-44
gi|13399308|ref|NP_080122.1| related RAS viral (r-ras) oncogene ... 179 4e-44
gi|41054748|ref|NP_955827.1| RAS related protein 1b [Danio rerio... 178 7e-44
gi|48105901|ref|XP_393035.1| similar to ENSANGP00000016959 [Apis... 177 9e-44
gi|50747790|ref|XP_420993.1| PREDICTED: similar to related RAS v... 177 9e-44
gi|31206299|ref|XP_312101.1| ENSANGP00000016959 [Anopheles gambi... 177 1e-43
gi|23506657|gb|AAN37908.1| ras-like protein Ras1 [Ustilago maydis] 177 1e-43
gi|17535679|ref|NP_496623.1| R-RAS related, viral oncogene homol... 177 1e-43
gi|39591432|emb|CAE73486.1| Hypothetical protein CBG20938 [Caeno... 177 1e-43
gi|47559056|gb|AAT35576.1| Rap 1A GTPase [Xenopus laevis] >gnl|B... 177 1e-43
gi|47559058|gb|AAT35577.1| Rap 1A2 GTPase [Xenopus laevis] >gnl|... 176 3e-43
gi|4204833|gb|AAD10840.1| Rap1b 175 4e-43
gi|9297051|sp|Q94694|RAP1_PHYPO Ras-related protein Rap-1 (Pprap... 175 4e-43
gi|27924412|gb|AAH44988.1| Rap1b-prov protein [Xenopus laevis] 175 6e-43
gi|7661678|ref|NP_056461.1| RAP1B, member of RAS oncogene family... 175 6e-43
gi|539995|pir||A61216 transforming protein rap1b - rat (strain C... 175 6e-43
gi|2130655|gb|AAB58345.1| Pprap1 protein [Physarum polycephalum] 175 6e-43
gi|1346954|sp|P22279|RAS2_RHIRA Ras-like protein 2 >gnl|BL_ORD_I... 175 6e-43
gi|31240013|ref|XP_320420.1| ENSANGP00000009196 [Anopheles gambi... 174 7e-43
gi|50418419|gb|AAH78173.1| RAP1B, member of RAS oncogene family ... 173 2e-42
gi|47214376|emb|CAG00857.1| unnamed protein product [Tetraodon n... 173 2e-42
gi|50344960|ref|NP_001002152.1| zgc:86676 [Danio rerio] >gnl|BL_... 172 3e-42
gi|68944|pir||TVFFR transforming protein homolog ras-64B - fruit... 172 3e-42
gi|28556888|dbj|BAC57522.1| ras-related protein RAP-1B homologue... 172 5e-42
gi|49118305|gb|AAH73313.1| Unknown (protein for MGC:80716) [Xeno... 172 5e-42
gi|50760377|ref|XP_417994.1| PREDICTED: similar to turkey RAP1Ab... 171 6e-42
gi|4506413|ref|NP_002875.1| RAP1A, member of RAS oncogene family... 171 6e-42
gi|24639550|ref|NP_726881.1| CG2849-PB [Drosophila melanogaster]... 171 6e-42
gi|190850|gb|AAA36542.1| GTP-binding protein (ral) >gnl|BL_ORD_I... 171 8e-42
gi|33946329|ref|NP_005393.2| ras related v-ral simian leukemia v... 171 8e-42
gi|31240015|ref|XP_320421.1| ENSANGP00000023453 [Anopheles gambi... 171 1e-41
gi|100996|pir||B36365 transforming protein homolog MRAS2 - Rhizo... 171 1e-41
gi|50732996|ref|XP_418863.1| PREDICTED: similar to ras related v... 171 1e-41
gi|41056021|ref|NP_957312.1| similar to v-ral simian leukemia vi... 171 1e-41
gi|7497401|pir||T32953 hypothetical protein C44C11.1 - Caenorhab... 170 1e-41
gi|13592039|ref|NP_112355.1| ras related v-ral simian leukemia v... 170 1e-41
gi|12851417|dbj|BAB29033.1| unnamed protein product [Mus musculus] 168 5e-41
gi|131854|sp|P22123|RAPA_DISOM Ras-related protein O-Krev >gnl|B... 168 7e-41
gi|5454028|ref|NP_006261.1| related RAS viral (r-ras) oncogene h... 168 7e-41
gi|30583789|gb|AAP36143.1| Homo sapiens related RAS viral (r-ras... 168 7e-41
gi|31210165|ref|XP_314049.1| ENSANGP00000015690 [Anopheles gambi... 167 9e-41
gi|34871550|ref|XP_220535.2| similar to Ras-related protein R-Ra... 167 9e-41
gi|103719|pir||F38625 GTP-binding protein o-Krev - electric ray ... 167 9e-41
gi|30584187|gb|AAP36342.1| Homo sapiens v-ral simian leukemia vi... 167 9e-41
gi|17933550|ref|NP_525063.1| CG2849-PC [Drosophila melanogaster]... 167 9e-41
gi|9247092|gb|AAF86279.1| Ras related small G protein RAL-A [Xen... 167 9e-41
gi|4506405|ref|NP_002872.1| v-ral simian leukemia viral oncogene... 167 9e-41
gi|50750662|ref|XP_422085.1| PREDICTED: similar to Ras-related p... 167 1e-40
gi|6677819|ref|NP_033127.1| Harvey rat sarcoma oncogene, subgrou... 167 2e-40
gi|48136808|ref|XP_396784.1| similar to ENSANGP00000009196 [Apis... 167 2e-40
gi|50417056|gb|AAH78184.1| Unknown (protein for MGC:100801) [Dan... 166 2e-40
gi|34098770|sp|Q9YH09|RALB_XENLA Ras-related protein Ral-B >gnl|... 166 2e-40
gi|11612509|ref|NP_071722.1| v-ral simian leukemia viral oncogen... 166 2e-40
gi|47933428|gb|AAT39341.1| Ras-related protein RAP1 [Oikopleura ... 166 3e-40
gi|1942609|pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Doub... 166 3e-40
gi|131850|sp|P18613|RAP1_DICDI Ras-related protein Rap-1 >gnl|BL... 166 3e-40
gi|34856057|ref|XP_341852.1| similar to RAS-RELATED PROTEIN R-RA... 166 3e-40
gi|16758670|ref|NP_446273.1| v-ral simian leukemia viral oncogen... 166 3e-40
gi|131837|sp|P22124|RAL_DISOM Ras-related protein O-RAL >gnl|BL_... 166 3e-40
gi|14595132|dbj|BAB61868.1| Raichu404X [Homo sapiens] 166 3e-40
gi|5821936|pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp I... 166 3e-40
gi|422507|pir||S09554 transforming protein (D-ras-2) - fruit fly... 166 3e-40
gi|47937473|gb|AAH72046.1| MGC78904 protein [Xenopus laevis] 166 3e-40
gi|26328909|dbj|BAC28193.1| unnamed protein product [Mus musculus] 166 3e-40
gi|34811640|pdb|1UAD|A Chain A, Crystal Structure Of The Rala-Gp... 165 4e-40
gi|50344902|ref|NP_001002123.1| zgc:86798 [Danio rerio] >gnl|BL_... 165 6e-40
gi|17137290|ref|NP_477211.1| CG8418-PA [Drosophila melanogaster]... 164 7e-40
gi|6531636|gb|AAF15517.1| TC21 ras-related [Drosophila melanogas... 164 1e-39
gi|47214681|emb|CAF97205.1| unnamed protein product [Tetraodon n... 164 1e-39
gi|48101484|ref|XP_395139.1| similar to ENSANGP00000015690 [Apis... 163 2e-39
gi|32404610|ref|XP_322918.1| RAS-2 PROTEIN [Neurospora crassa] >... 163 2e-39
gi|19705451|ref|NP_599173.1| RAP1B, member of RAS oncogene famil... 163 2e-39
gi|45383191|ref|NP_989820.1| R-Ras3 [Gallus gallus] >gnl|BL_ORD_... 163 2e-39
gi|627254|pir||B54321 transforming protein ras-2, hepatic - rain... 163 2e-39
gi|39588853|emb|CAE69483.1| Hypothetical protein CBG15686 [Caeno... 162 3e-39
gi|17556130|ref|NP_497689.1| v-ral simian leukemia viral oncogen... 162 3e-39
gi|103721|pir||E38625 GTP-binding protein o-ral - electric ray (... 162 4e-39
gi|47221168|emb|CAG05489.1| unnamed protein product [Tetraodon n... 162 5e-39
gi|1113079|dbj|BAA03708.1| NC-ras-2 protein [Neurospora crassa] 162 5e-39
gi|32189357|ref|NP_036351.2| muscle RAS oncogene homolog; muscle... 162 5e-39
gi|49115017|gb|AAH72861.1| Unknown (protein for MGC:80266) [Xeno... 162 5e-39
gi|1109580|gb|AAA83021.1| RAS gene product 161 8e-39
gi|6678930|ref|NP_032650.1| muscle and microspikes RAS [Mus musc... 161 8e-39
gi|6226045|sp|O14807|RASM_HUMAN Ras-related protein M-Ras (Ras-r... 161 8e-39
gi|6981222|ref|NP_037113.1| muscle and microspikes RAS [Rattus n... 161 8e-39
gi|1710782|sp|P52498|RSR1_CANAL Ras-related protein RSR1 >gnl|BL... 160 1e-38
gi|1890279|gb|AAB50559.1| c-H-ras [Mus musculus] >gnl|BL_ORD_ID|... 160 1e-38
gi|33112058|gb|AAP94030.1| RasB [Aspergillus fumigatus] >gnl|BL_... 160 2e-38
gi|46137197|ref|XP_390290.1| conserved hypothetical protein [Gib... 159 3e-38
gi|50428145|ref|XP_458406.1| unnamed protein product [Debaryomyc... 159 4e-38
gi|47229149|emb|CAG03901.1| unnamed protein product [Tetraodon n... 159 4e-38
gi|280922|pir||A43808 transforming protein (ras-1) - bovine (fra... 159 4e-38
gi|2500062|sp|Q60529|RASH_MESAU Transforming protein p21/H-Ras-1... 159 4e-38
gi|15029734|gb|AAH11083.1| Hras1 protein [Mus musculus] 159 4e-38
gi|48097817|ref|XP_393895.1| similar to muscle RAS oncogene homo... 157 9e-38
gi|9488655|gb|AAC60676.2| N-ras [Rattus sp.] 157 9e-38
gi|68928|pir||TVGPRT GTP-binding protein N-ras, short splice for... 157 9e-38
gi|553635|gb|AAA36554.1| c-Ki-ras p21 protein 157 1e-37
gi|405070|gb|AAA21446.1| ras homologue 1 157 2e-37
gi|50547057|ref|XP_500998.1| hypothetical protein [Yarrowia lipo... 156 2e-37
gi|50556738|ref|XP_505777.1| hypothetical protein [Yarrowia lipo... 156 3e-37
gi|34534687|dbj|BAC87080.1| unnamed protein product [Homo sapiens] 156 3e-37
gi|554503|gb|AAA42011.1| Ki-ras protein 156 3e-37
gi|553638|gb|AAA36556.1| N-ras protein (transforming allele) 155 3e-37
gi|47222817|emb|CAF96484.1| unnamed protein product [Tetraodon n... 155 5e-37
gi|46129264|ref|XP_388993.1| hypothetical protein FG08817.1 [Gib... 155 5e-37
gi|553633|gb|AAA36548.1| N-ras protein 155 5e-37
gi|38107600|gb|EAA53749.1| hypothetical protein MG09499.4 [Magna... 154 8e-37
gi|50603602|gb|AAH77235.1| Unknown (protein for MGC:79097) [Xeno... 154 8e-37
gi|12751117|gb|AAK07551.1| PNAS-140 [Homo sapiens] 154 8e-37
gi|37619841|emb|CAB02777.2| Hypothetical protein C25D7.7 [Caenor... 153 2e-36
gi|6677755|ref|NP_033095.1| Ras-like without CAAX 1; RAS-like pr... 153 2e-36
gi|5902050|ref|NP_008843.1| Ras-like without CAAX 1; Ric-like, e... 152 4e-36
gi|39583352|emb|CAE66326.1| Hypothetical protein CBG11577 [Caeno... 152 5e-36
gi|26338129|dbj|BAC32750.1| unnamed protein product [Mus musculus] 151 9e-36
gi|3434937|dbj|BAA32410.1| krev-1 [Neurospora crassa] 150 2e-35
gi|6677747|ref|NP_033091.1| Ras-like without CAAX 2; RAS-like pr... 150 2e-35
gi|34878614|ref|XP_214590.2| similar to GTP-binding protein ROC2... 149 2e-35
gi|17390126|gb|AAH18060.1| Ras-like without CAAX 2 [Homo sapiens] 149 3e-35
gi|405072|gb|AAA21447.1| ras homologue 2 149 3e-35
gi|38707392|dbj|BAD04019.1| Ras protein [Schizophyllum commune] 149 3e-35
gi|47225282|emb|CAG09782.1| unnamed protein product [Tetraodon n... 149 3e-35
gi|4506533|ref|NP_002921.1| Ras-like without CAAX 2; Ric-like, e... 148 6e-35
gi|37779076|gb|AAP20198.1| RAP2B-like protein [Pagrus major] 148 6e-35
gi|405066|gb|AAA21444.1| rap homologue 1 148 7e-35
gi|27694827|gb|AAH43998.1| Rap2c-prov protein [Xenopus laevis] 147 1e-34
gi|47122956|gb|AAH70626.1| Unknown (protein for MGC:81417) [Xeno... 147 1e-34
gi|28175267|gb|AAH45215.1| Rap-2-prov protein [Xenopus laevis] >... 147 2e-34
gi|27695324|gb|AAH43066.1| Unknown (protein for IMAGE:5709337) [... 146 2e-34
gi|6321591|ref|NP_011668.1| Gtp-binding protein of the ras super... 146 2e-34
gi|40254160|ref|NP_083795.2| RIKEN cDNA 5830461H18 [Mus musculus... 146 2e-34
gi|13386338|ref|NP_082988.1| RAP2B, member of RAS oncogene famil... 146 2e-34
gi|68950|pir||TVHUR2 transforming protein rap2b - human >gnl|BL_... 146 2e-34
gi|39578579|gb|AAR28683.1| small GTPase Rap2 [Xenopus laevis] >g... 146 2e-34
gi|29144971|gb|AAH49084.1| Unknown (protein for IMAGE:5706690) [... 146 2e-34
gi|2780995|pdb|1KAO| Crystal Structure Of The Small G Protein R... 146 3e-34
gi|1656003|gb|AAB42214.1| rin [Homo sapiens] 146 3e-34
gi|50745736|ref|XP_420220.1| PREDICTED: similar to Rap2c-prov pr... 146 3e-34
gi|10518344|ref|NP_066361.1| RAP2A, member of RAS oncogene famil... 146 3e-34
gi|50259164|gb|EAL21841.1| hypothetical protein CNBC5420 [Crypto... 145 4e-34
gi|40675538|gb|AAH64814.1| Rap2c protein [Mus musculus] 145 4e-34
gi|20147737|gb|AAM12636.1| Ras family small GTP binding protein ... 145 4e-34
gi|50811628|ref|XP_422862.1| PREDICTED: similar to GTP-binding p... 145 4e-34
gi|27369539|ref|NP_766001.1| RAP2C, member of RAS oncogene famil... 145 4e-34
gi|29477081|gb|AAH50056.1| Rap2c protein [Mus musculus] 145 4e-34
gi|31228386|ref|XP_318045.1| ENSANGP00000010698 [Anopheles gambi... 145 4e-34
gi|2116982|dbj|BAA20127.1| Rap 1B [Rattus norvegicus] 145 5e-34
gi|48143221|ref|XP_397415.1| similar to CG3204-PA [Apis mellifera] 145 6e-34
gi|8133108|gb|AAF73473.1| Ras1p [Schizophyllum commune] 145 6e-34
gi|47208327|emb|CAG06324.1| unnamed protein product [Tetraodon n... 145 6e-34
gi|3043765|gb|AAC13247.1| ras p21 [Canis familiaris] >gnl|BL_ORD... 145 6e-34
gi|24636154|gb|AAN63433.1| R-ras related protein 1, isoform b [C... 144 8e-34
gi|405068|gb|AAA21445.1| rap homologue 2 144 8e-34
gi|3043763|gb|AAC13246.1| ras p21 [Canis familiaris] >gnl|BL_ORD... 144 8e-34
gi|27693629|gb|AAH27363.2| RIKEN cDNA 2010200P20 gene [Mus muscu... 144 8e-34
gi|13097300|gb|AAH03403.1| RAP2C, member of RAS oncogene family ... 144 1e-33
gi|47208127|emb|CAF98163.1| unnamed protein product [Tetraodon n... 144 1e-33
gi|50305553|ref|XP_452736.1| unnamed protein product [Kluyveromy... 143 2e-33
gi|49070746|ref|XP_399662.1| hypothetical protein UM02047.1 [Ust... 143 2e-33
gi|48926639|ref|NP_001001729.1| RAP2B, member of RAS oncogene fa... 143 2e-33
gi|40644070|emb|CAE18159.1| Ral protein [Echinococcus multilocul... 142 3e-33
gi|45198982|ref|NP_986011.1| AFR464Wp [Eremothecium gossypii] >g... 142 4e-33
gi|17137620|ref|NP_477402.1| CG3204-PA [Drosophila melanogaster]... 142 5e-33
gi|17554726|ref|NP_497972.1| R-RAS related, associated to muscle... 141 7e-33
gi|6093897|sp|Q91079|RAS_LIMLI RAS-LIKE PROTEIN >gnl|BL_ORD_ID|4... 141 9e-33
gi|49097018|ref|XP_409969.1| hypothetical protein AN5832.2 [Aspe... 140 1e-32
gi|39591566|emb|CAE71142.1| Hypothetical protein CBG17997 [Caeno... 140 1e-32
gi|17558200|ref|NP_506707.1| vertebrate Rap GTPase homolog (rap-... 140 2e-32
gi|213476|gb|AAA49428.1| ras p21 140 2e-32
gi|40644072|emb|CAE18160.1| Ral protein [Echinococcus multilocul... 139 3e-32
gi|1364081|pir||PC4098 Ha-ras protein - red mullet (fragment) >g... 139 3e-32
gi|213474|gb|AAA49427.1| ras-1 protein 139 3e-32
gi|50552590|ref|XP_503705.1| hypothetical protein [Yarrowia lipo... 139 4e-32
gi|28828051|gb|AAO50735.1| similar to Dictyostelium discoideum (... 138 7e-32
gi|50286789|ref|XP_445824.1| unnamed protein product [Candida gl... 137 1e-31
gi|32417758|ref|XP_329357.1| hypothetical protein [Neurospora cr... 137 1e-31
gi|5305125|emb|CAA40405.2| H-ras proto-oncogene [Oryctolagus cun... 136 2e-31
gi|68952|pir||TVFFR3 transforming protein ras3 - fruit fly (Dros... 136 3e-31
gi|21392164|gb|AAM48436.1| RE62293p [Drosophila melanogaster] 135 5e-31
gi|213481|gb|AAA49430.1| ras-2 protein 135 5e-31
gi|3930774|gb|AAC82784.1| N-ras [Mesocricetus auratus] 135 5e-31
gi|7638419|gb|AAF65466.1| Ras2p [Suillus bovinus] 135 6e-31
gi|47227031|emb|CAG05923.1| unnamed protein product [Tetraodon n... 135 6e-31
gi|42733682|gb|AAS38626.1| hypothetical protein [Dictyostelium d... 133 2e-30
gi|47199784|emb|CAF89306.1| unnamed protein product [Tetraodon n... 125 2e-30
gi|50255782|gb|EAL18514.1| hypothetical protein CNBJ1560 [Crypto... 133 2e-30
gi|29841085|gb|AAP06098.1| similar to XM_003032 RAP2B, member of... 131 9e-30
gi|9972134|gb|AAG10598.1| Ras2 [Filobasidiella neoformans] 129 3e-29
gi|92024|pir||B25229 c-H-ras 2 protein - rat (fragment) >gnl|BL_... 128 6e-29
gi|47208126|emb|CAF98162.1| unnamed protein product [Tetraodon n... 127 1e-28
gi|29841014|gb|AAP06027.1| similar to NM_012219 muscle RAS oncog... 126 3e-28
gi|41015992|dbj|BAD07406.1| Ras-related protein 3 [Entamoeba his... 125 5e-28
gi|2286103|gb|AAB64247.1| RIBA [Homo sapiens] 125 7e-28
gi|49094722|ref|XP_408822.1| hypothetical protein AN4685.2 [Aspe... 124 9e-28
gi|34933451|ref|XP_228756.2| similar to small GTPase protein E-R... 124 9e-28
gi|29841225|gb|AAP06238.1| similar to GenBank Accession Number U... 124 1e-27
gi|384064|prf||1905199A c-N-ras gene 123 2e-27
gi|2116980|dbj|BAA20126.1| Rap 1A [Rattus norvegicus] 122 4e-27
gi|47226854|emb|CAG06696.1| unnamed protein product [Tetraodon n... 121 9e-27
gi|31559833|ref|NP_853510.1| small GTPase protein E-Ras; v-Ha-ra... 121 9e-27
gi|2147402|pir||I46914 gene K-ras protein - dog (fragment) >gnl|... 121 9e-27
gi|31559801|ref|NP_853526.1| ES cell-expressed Ras; small GTPase... 120 2e-26
gi|1771555|emb|CAA64716.1| R-ras protein [Rivulus marmoratus] 120 2e-26
gi|46445071|gb|EAL04342.1| hypothetical protein CaO19.13415 [Can... 119 4e-26
gi|131887|sp|P24498|RAS_GEOCY Ras-like protein >gnl|BL_ORD_ID|48... 118 8e-26
gi|39593724|emb|CAE62016.1| Hypothetical protein CBG06025 [Caeno... 118 8e-26
gi|17538562|ref|NP_502095.1| predicted CDS, vertebrate Rap GTPas... 116 2e-25
gi|50554407|ref|XP_504612.1| hypothetical protein [Yarrowia lipo... 114 9e-25
gi|32420993|ref|XP_330940.1| hypothetical protein ( (AF342329) r... 113 2e-24
gi|50408325|ref|XP_456771.1| unnamed protein product [Debaryomyc... 113 3e-24
gi|14249704|ref|NP_116307.1| RAS-like, estrogen-regulated, growt... 112 3e-24
gi|32526869|ref|NP_871788.1| RAS-like, estrogen-regulated, growt... 112 3e-24
gi|213483|gb|AAA49431.1| ras-2 protein 112 4e-24
gi|50729046|ref|XP_416404.1| PREDICTED: similar to RAS-like, est... 110 1e-23
gi|103720|pir||D38625 GTP-binding protein o-rab1 - electric ray ... 110 1e-23
gi|38100347|gb|EAA47484.1| hypothetical protein MG02727.4 [Magna... 108 5e-23
gi|2924319|emb|CAA05774.1| GTP binding protein [Trypanosoma brucei] 108 5e-23
gi|1335027|emb|CAA26593.1| unnamed protein product [Homo sapiens] 108 6e-23
gi|27924279|gb|AAH45014.1| Rab1-prov protein [Xenopus laevis] >g... 107 1e-22
gi|131785|sp|P22125|RAB1_DISOM Ras-related protein ORAB-1 >gnl|B... 107 1e-22
gi|27817324|emb|CAD61089.1| SI:zC101N13.3 (novel protein similar... 107 1e-22
gi|16758566|ref|NP_446193.1| rap2A-like protein [Rattus norvegic... 107 2e-22
gi|47202518|emb|CAF87531.1| unnamed protein product [Tetraodon n... 107 2e-22
gi|47202387|emb|CAF87426.1| unnamed protein product [Tetraodon n... 107 2e-22
gi|21553323|ref|NP_660156.1| small GTP-binding tumor suppressor ... 106 2e-22
gi|131787|sp|P05711|RB1A_RAT Ras-related protein Rab-1A >gnl|BL_... 106 2e-22
gi|12962251|gb|AAK10807.1| ras protein [Sclerotinia sclerotiorum... 106 2e-22
gi|1335026|emb|CAA25828.1| unnamed protein product [Homo sapiens] 106 2e-22
gi|34871425|ref|XP_341051.1| similar to paired immunoglobin-like... 106 3e-22
gi|50738954|ref|XP_419342.1| PREDICTED: similar to ras-related p... 106 3e-22
gi|4758988|ref|NP_004152.1| RAB1A, member RAS oncogene family; R... 106 3e-22
gi|47211161|emb|CAF92536.1| unnamed protein product [Tetraodon n... 105 4e-22
gi|20135848|emb|CAD29462.1| Ras2 protein [Pleuronectes platessa] 105 5e-22
gi|2135785|pir||I38149 N-ras oncogene - human (fragment) >gnl|BL... 105 7e-22
gi|41152266|ref|NP_957023.1| hypothetical protein MGC73144 [Dani... 104 9e-22
gi|27695152|gb|AAH43818.1| Rheb-prov protein [Xenopus laevis] 104 9e-22
gi|48104721|ref|XP_392967.1| similar to CG3320-PA [Apis mellifera] 103 2e-21
gi|41055496|ref|NP_957436.1| similar to RAB1, member RAS oncogen... 103 2e-21
gi|28571523|ref|NP_730950.2| CG1081-PA [Drosophila melanogaster]... 103 2e-21
gi|50730669|ref|XP_425593.1| PREDICTED: similar to rap2A-like pr... 103 2e-21
gi|37360618|dbj|BAC98287.1| mKIAA3012 protein [Mus musculus] 103 2e-21
gi|48098905|ref|XP_392564.1| similar to CG1081-PA [Apis mellifera] 103 2e-21
gi|49256313|gb|AAH74392.1| Unknown (protein for MGC:84355) [Xeno... 103 3e-21
gi|14388336|dbj|BAB60730.1| hypothetical protein [Macaca fascicu... 103 3e-21
gi|20135846|emb|CAD29461.1| Ras1 protein [Pleuronectes platessa] 103 3e-21
gi|21703367|ref|NP_060064.2| Di-Ras2 [Homo sapiens] >gnl|BL_ORD_... 102 3e-21
gi|41148993|ref|XP_372086.1| similar to RAB1B, member RAS oncoge... 102 3e-21
gi|31208125|ref|XP_313029.1| ENSANGP00000011746 [Anopheles gambi... 102 3e-21
gi|7438373|pir||S72515 GTP-binding protein RAB1 - garden petunia... 102 3e-21
gi|47218272|emb|CAF96309.1| unnamed protein product [Tetraodon n... 102 5e-21
gi|825697|emb|CAA37384.1| G1III6 N-ras [Homo sapiens] 102 5e-21
gi|464524|sp|Q05974|RAB1_LYMST Ras-related protein Rab-1A >gnl|B... 102 6e-21
gi|34862705|ref|XP_345791.1| similar to small GTP-binding tumor ... 102 6e-21
gi|7438417|pir||JE0318 GTP-binding protein rabB - silkworm >gnl|... 102 6e-21
gi|1381678|gb|AAB97115.1| small GTP-binding protein [Glycine max] 101 8e-21
gi|21644583|ref|NP_660252.1| DIRAS family, GTP-binding RAS-like ... 101 8e-21
gi|23307609|gb|AAN17787.1| Ras homolog enriched in brain [Asperg... 101 8e-21
gi|27683409|ref|XP_225214.1| similar to Di-Ras2 [Rattus norvegic... 101 1e-20
gi|92339|pir||S06147 GTP-binding protein rab1B - rat >gnl|BL_ORD... 100 1e-20
gi|5032041|ref|NP_005605.1| Ras homolog enriched in brain; Ras-h... 100 2e-20
gi|30584151|gb|AAP36324.1| Homo sapiens Ras homolog enriched in ... 100 2e-20
gi|227603|prf||1707300A guanine nucleotide binding protein 100 2e-20
gi|6981476|ref|NP_037348.1| Ras homolog enriched in brain [Rattu... 100 2e-20
gi|28626508|ref|NP_444305.2| RAS-homolog enriched in brain [Mus ... 100 2e-20
gi|19111986|ref|NP_595194.1| putative ras-related GTP-binding pr... 100 2e-20
gi|303748|dbj|BAA02115.1| GTP-binding protein [Pisum sativum] >g... 100 3e-20
gi|13569962|ref|NP_112243.1| RAB1B, member RAS oncogene family; ... 100 3e-20
gi|49065350|emb|CAG38493.1| RAB1B [Homo sapiens] 100 3e-20
gi|50292669|ref|XP_448767.1| unnamed protein product [Candida gl... 100 3e-20
gi|32527715|gb|AAP86259.1| Ac2-048 [Rattus norvegicus] 100 3e-20
gi|27709432|ref|XP_229035.1| similar to Ras-related protein Rab-... 99 4e-20
gi|131803|sp|P10536|RB1B_RAT Ras-related protein Rab-1B >gnl|BL_... 99 4e-20
gi|21313162|ref|NP_083852.1| RIKEN cDNA 1110011F09 [Mus musculus... 99 4e-20
gi|466170|sp|P16976|YPT1_MAIZE GTP-binding protein YPTM1 >gnl|BL... 99 4e-20
gi|50305673|ref|XP_452797.1| unnamed protein product [Kluyveromy... 99 4e-20
gi|42490908|gb|AAH66307.1| Ras homolog enriched in brain [Homo s... 99 4e-20
gi|49258009|gb|AAH74244.1| Unknown (protein for MGC:83985) [Xeno... 99 5e-20
gi|50767046|ref|XP_423026.1| PREDICTED: similar to Azi2 protein ... 99 5e-20
gi|41054159|ref|NP_956125.1| small GTP-binding tumor suppressor ... 99 5e-20
gi|38083654|ref|XP_356992.1| similar to rin [Mus musculus] 99 7e-20
gi|541978|pir||S41430 GTP-binding protein, ras-like (clone vfa-y... 99 7e-20
gi|24648682|ref|NP_732610.1| CG3320-PA [Drosophila melanogaster]... 98 9e-20
gi|1370162|emb|CAA66447.1| RAB1A [Lotus corniculatus var. japoni... 98 9e-20
gi|17553566|ref|NP_499079.1| ras-related GTP-binding protein lik... 98 9e-20
gi|31241467|ref|XP_321164.1| ENSANGP00000020811 [Anopheles gambi... 98 9e-20
gi|49130957|ref|XP_413005.1| conserved hypothetical protein [Asp... 98 9e-20
gi|19115492|ref|NP_594580.1| ypt1-related protein 2 [Schizosacch... 98 1e-19
gi|34882806|ref|XP_229263.2| similar to Ras-related protein Rab-... 97 1e-19
gi|34914060|ref|NP_918377.1| putative RIC1_ORYSA RAS-RELATED PRO... 97 1e-19
gi|541948|pir||S39565 GTP-binding protein rab1 - soybean >gnl|BL... 97 1e-19
gi|10119859|dbj|BAB13483.1| Ras homolog [Mus musculus] 97 1e-19
gi|1772345|dbj|BAA11211.1| ras-related GTP-binding protein [Homo... 97 1e-19
gi|34853590|ref|XP_229401.2| similar to Ras-related protein Rab-... 97 1e-19
gi|1053065|gb|AAA80679.1| small GTP-binding protein 97 1e-19
gi|39588485|emb|CAE58008.1| Hypothetical protein CBG01077 [Caeno... 97 2e-19
gi|17558550|ref|NP_503397.1| RAB family member (22.5 kD) (rab-1)... 97 2e-19
gi|4506363|ref|NP_002861.1| RAB13, member RAS oncogene family; R... 97 2e-19
gi|10129780|emb|CAC08198.1| putative GTP-binding protein [Kluyve... 97 2e-19
gi|49257311|gb|AAH73168.1| RAB13 protein [Homo sapiens] 97 2e-19
gi|42733742|gb|AAS38677.1| similar to putative ras-related GTP-b... 97 2e-19
gi|40225607|gb|AAH09227.2| RAB13 protein [Homo sapiens] 97 2e-19
gi|50554323|ref|XP_504570.1| hypothetical protein [Yarrowia lipo... 97 2e-19
gi|1370170|emb|CAA98162.1| RAB1E [Lotus corniculatus var. japoni... 97 2e-19
gi|45185452|ref|NP_983169.1| ABR220Wp [Eremothecium gossypii] >g... 97 2e-19
gi|38109427|gb|EAA55305.1| hypothetical protein MG06962.4 [Magna... 97 2e-19
gi|1370168|emb|CAA98161.1| RAB1D [Lotus corniculatus var. japoni... 96 3e-19
gi|11558649|emb|CAC17833.1| secretion related GTPase (SrgB) [Asp... 96 3e-19
gi|7533034|gb|AAF63333.1| YptA [Aspergillus awamori] 96 3e-19
gi|32414807|ref|XP_327883.1| hypothetical protein [Neurospora cr... 96 3e-19
gi|134228|sp|P20790|SAS1_DICDI GTP-binding protein SAS1 >gnl|BL_... 96 3e-19
gi|49093914|ref|XP_408418.1| YPT1_NEUCR GTP-binding protein ypt1... 96 3e-19
gi|11558500|emb|CAC17744.1| small GTP-binding protein YPTI [Hypo... 96 3e-19
gi|46138717|ref|XP_391049.1| YPT1_NEUCR GTP-binding protein ypt1... 96 3e-19
gi|730510|sp|P40392|RIC1_ORYSA Ras-related protein RIC1 >gnl|BL_... 96 3e-19
gi|4586580|dbj|BAA76422.1| rab-type small GTP-binding protein [C... 96 4e-19
gi|18447913|dbj|BAB84322.1| ras-related protein RAB8-1 [Nicotian... 96 6e-19
gi|1362066|pir||S57471 GTP-binding protein GTP6 - garden pea >gn... 96 6e-19
gi|14318480|ref|NP_116615.1| Ras-like small GTPase, involved in ... 96 6e-19
gi|4293|emb|CAA25036.1| unnamed protein product [Saccharomyces c... 96 6e-19
gi|24645521|ref|NP_649948.1| CG8500-PA [Drosophila melanogaster]... 96 6e-19
gi|47229898|emb|CAG10312.1| unnamed protein product [Tetraodon n... 96 6e-19
gi|31243023|ref|XP_321946.1| ENSANGP00000013866 [Anopheles gambi... 96 6e-19
gi|929681|emb|CAA25160.1| unnamed protein product [Mus musculus] 95 7e-19
gi|15077428|gb|AAK83158.1| small GTP-binding protein Ypt1p [Cand... 95 7e-19
gi|1370166|emb|CAA98160.1| RAB1C [Lotus corniculatus var. japoni... 95 7e-19
gi|466171|sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 >gnl|BL_... 95 9e-19
gi|50306647|ref|XP_453297.1| unnamed protein product [Kluyveromy... 95 9e-19
gi|32418088|ref|XP_329522.1| GTP-BINDING PROTEIN YPT1 [Neurospor... 95 9e-19
gi|401686|sp|P31584|YPT1_VOLCA GTP-binding protein yptV1 >gnl|BL... 94 1e-18
gi|50413456|ref|XP_457265.1| unnamed protein product [Debaryomyc... 94 1e-18
gi|34935505|ref|XP_345726.1| similar to RAP2A, member of RAS onc... 94 1e-18
>gi|126498|sp|P22981|LT60_CAEEL Ras protein let-60
gi|102524|pir||A36290 let-60 ras protein - Caenorhabditis elegans
gi|3881788|emb|CAA92630.1| Hypothetical protein ZK792.6
[Caenorhabditis elegans]
Length = 184
Score = 348 bits (893), Expect = 4e-95
Identities = 176/184 (95%), Positives = 176/184 (95%)
Frame = -1
Query: 555 MTEYKLXXXXXXXXGKSALTIQLIQNHFVEEYDPTIEDSYRKQVVIDGETCLLDILDTAG 376
MTEYKL GKSALTIQLIQNHFVEEYDPTIEDSYRKQVVIDGETCLLDILDTAG
Sbjct: 1 MTEYKLVVVGDGGVGKSALTIQLIQNHFVEEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60
Query: 375 QEEYSAMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDL 196
QEEYSAMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDL
Sbjct: 61 QEEYSAMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDL 120
Query: 195 SSRSVDFRTVSETAKGYGIPNVDTSAKTRMGVDEAFYTLVREIRKHRERHDNNKPQKKKK 16
SSRSVDFRTVSETAKGYGIPNVDTSAKTRMGVDEAFYTLVREIRKHRERHDNNKPQKKKK
Sbjct: 121 SSRSVDFRTVSETAKGYGIPNVDTSAKTRMGVDEAFYTLVREIRKHRERHDNNKPQKKKK 180
Query: 15 CQIM 4
CQIM
Sbjct: 181 CQIM 184
>gi|32565695|ref|NP_502213.2| RAS protein, LEThal LET-60, abnormal
cell LINeage LIN-34 (let-60) [Caenorhabditis elegans]
gi|156356|gb|AAA28103.1| ras protein
Length = 187
Score = 348 bits (893), Expect = 4e-95
Identities = 176/184 (95%), Positives = 176/184 (95%)
Frame = -1
Query: 555 MTEYKLXXXXXXXXGKSALTIQLIQNHFVEEYDPTIEDSYRKQVVIDGETCLLDILDTAG 376
MTEYKL GKSALTIQLIQNHFVEEYDPTIEDSYRKQVVIDGETCLLDILDTAG
Sbjct: 4 MTEYKLVVVGDGGVGKSALTIQLIQNHFVEEYDPTIEDSYRKQVVIDGETCLLDILDTAG 63
Query: 375 QEEYSAMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDL 196
QEEYSAMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDL
Sbjct: 64 QEEYSAMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDL 123
Query: 195 SSRSVDFRTVSETAKGYGIPNVDTSAKTRMGVDEAFYTLVREIRKHRERHDNNKPQKKKK 16
SSRSVDFRTVSETAKGYGIPNVDTSAKTRMGVDEAFYTLVREIRKHRERHDNNKPQKKKK
Sbjct: 124 SSRSVDFRTVSETAKGYGIPNVDTSAKTRMGVDEAFYTLVREIRKHRERHDNNKPQKKKK 183
Query: 15 CQIM 4
CQIM
Sbjct: 184 CQIM 187