Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK945_2
(783 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535355|ref|NP_496177.1| proteasome Alpha Subunit (28.9 kD) ... 468 e-131
gi|42734293|emb|CAA88436.2| Hypothetical protein ZK945.2 [Caenor... 429 e-119
gi|39587803|emb|CAE67821.1| Hypothetical protein CBG13401 [Caeno... 404 e-111
gi|50748866|ref|XP_421435.1| PREDICTED: similar to Proteasome su... 200 3e-50
gi|542655|pir||S38529 C 3.4.25.1 proteasome endopeptidase comple... 199 7e-50
gi|20810439|gb|AAH29402.1| Proteasome alpha 3 subunit, isoform 1... 197 2e-49
gi|4506183|ref|NP_002779.1| proteasome alpha 3 subunit isoform 1... 197 2e-49
gi|48145983|emb|CAG33214.1| PSMA3 [Homo sapiens] 197 2e-49
gi|31981534|ref|NP_035314.2| proteasome (prosome, macropain) sub... 196 5e-49
gi|21465648|pdb|1IRU|G Chain G, Crystal Structure Of The Mammali... 196 6e-49
gi|3914438|sp|O70435|PSA3_MOUSE Proteasome subunit alpha type 3 ... 195 8e-49
gi|34849610|gb|AAH58201.1| MGC68557 protein [Xenopus laevis] 195 8e-49
gi|8394066|ref|NP_058976.1| proteasome (prosome, macropain) subu... 195 8e-49
gi|48096769|ref|XP_392518.1| similar to C 3.4.25.1 proteasome en... 193 4e-48
gi|48717106|ref|NP_001001347.1| proteasome subunit alpha type 3-... 193 4e-48
gi|23110939|ref|NP_687033.1| proteasome alpha 3 subunit isoform ... 191 2e-47
gi|30584117|gb|AAP36307.1| Homo sapiens proteasome (prosome, mac... 191 2e-47
gi|31241317|ref|XP_321089.1| ENSANGP00000018478 [Anopheles gambi... 190 3e-47
gi|47607474|gb|AAT36639.1| light organ C8 alpha proteasome subun... 187 2e-46
gi|50080306|gb|AAT69640.1| putative proteasome subunit alpha typ... 185 1e-45
gi|49076942|ref|XP_402391.1| hypothetical protein UM04776.1 [Ust... 183 3e-45
gi|38076740|ref|XP_110067.2| similar to proteasome alpha7/C8 sub... 182 9e-45
gi|34909168|ref|NP_915931.1| proteasome subunit alpha type 3 [Or... 178 1e-43
gi|38080867|ref|XP_358993.1| similar to proteasome alpha7/C8 sub... 178 1e-43
gi|38076158|ref|XP_122711.2| similar to proteasome alpha7/C8 sub... 177 2e-43
gi|14594925|emb|CAC43323.1| putative alpha7 proteasome subunit [... 174 2e-42
gi|38079802|ref|XP_147971.2| similar to proteasome alpha7/C8 sub... 172 5e-42
gi|3914431|sp|O24362|PSA3_SPIOL Proteasome subunit alpha type 3 ... 172 7e-42
gi|24652204|ref|NP_724834.1| CG1519-PA [Drosophila melanogaster]... 171 1e-41
gi|49096940|ref|XP_409930.1| hypothetical protein AN5793.2 [Aspe... 170 3e-41
gi|45188273|ref|NP_984496.1| ADR401Cp [Eremothecium gossypii] >g... 170 4e-41
gi|3914440|sp|Q27563|PSA3_DICDI Proteasome subunit alpha type 3 ... 169 5e-41
gi|15225839|ref|NP_180270.1| 20S proteasome alpha subunit G (PAG... 169 6e-41
gi|38107252|gb|EAA53450.1| hypothetical protein MG07727.4 [Magna... 167 3e-40
gi|2511592|emb|CAA74027.1| multicatalytic endopeptidase complex,... 166 4e-40
gi|19075540|ref|NP_588040.1| proteasome component c1 [Schizosacc... 164 1e-39
gi|50256001|gb|EAL18730.1| hypothetical protein CNBI3160 [Crypto... 164 3e-39
gi|50555423|ref|XP_505120.1| hypothetical protein [Yarrowia lipo... 161 1e-38
gi|32422497|ref|XP_331692.1| hypothetical protein [Neurospora cr... 160 2e-38
gi|50289259|ref|XP_447060.1| unnamed protein product [Candida gl... 160 3e-38
gi|46107362|ref|XP_380740.1| hypothetical protein FG00564.1 [Gib... 158 1e-37
gi|46228188|gb|EAK89087.1| proteasome subunit alpha type 3, NTN ... 157 2e-37
gi|2582508|gb|AAB82572.1| 20S proteasome alpha7 subunit [Drosoph... 157 2e-37
gi|3914413|sp|P90513|PSA3_ACACA Proteasome subunit alpha type 3 ... 155 9e-37
gi|11513997|pdb|1G0U|F Chain F, A Gated Channel Into The Proteas... 154 3e-36
gi|6324938|ref|NP_015007.1| 20S proteasome alpha-type subunit; P... 154 3e-36
gi|14488811|pdb|1FNT|G Chain G, Crystal Structure Of The 20s Pro... 152 1e-35
gi|3114275|pdb|1RYP|G Chain G, Crystal Structure Of The 20s Prot... 148 1e-34
gi|28573936|ref|NP_523668.3| CG1519-PB [Drosophila melanogaster]... 143 4e-33
gi|9622228|gb|AAF89683.1| 20S proteasome alpha 7 subunit [Trypan... 126 6e-28
gi|47214803|emb|CAF89630.1| unnamed protein product [Tetraodon n... 114 3e-24
gi|16805254|ref|NP_473282.1| proteasome component C8, putative [... 114 3e-24
gi|1709761|sp|P52427|PSA4_SPIOL Proteasome subunit alpha type 4 ... 109 6e-23
gi|12229904|sp|O82530|PSA4_PETHY Proteasome subunit alpha type 4... 108 1e-22
gi|15233268|ref|NP_188850.1| 20S proteasome alpha subunit C (PAC... 107 2e-22
gi|6984140|gb|AAF34770.1| proteasome 27 kDa subunit [Euphorbia e... 106 5e-22
gi|2511584|emb|CAA73624.1| multicatalytic endopeptidase [Arabido... 106 6e-22
gi|50424395|ref|XP_460784.1| unnamed protein product [Debaryomyc... 105 1e-21
gi|14594915|emb|CAC43318.1| putative alpha3 proteasome subunit [... 102 7e-21
gi|34898458|ref|NP_910575.1| ESTs AU058081(E3082),AU075427(E3038... 102 1e-20
gi|34898416|ref|NP_910554.1| ESTs AU058081(E30812),AU058365(E506... 102 1e-20
gi|15678713|ref|NP_275829.1| proteasome, alpha subunit [Methanot... 102 1e-20
gi|38111874|gb|EAA57374.1| hypothetical protein MG08343.4 [Magna... 100 3e-20
gi|23394356|gb|AAN31468.1| proteasome subunit [Phytophthora infe... 100 3e-20
gi|49070744|ref|XP_399661.1| hypothetical protein UM02046.1 [Ust... 100 3e-20
gi|46442797|gb|EAL02084.1| hypothetical protein CaO19.13935 [Can... 100 5e-20
gi|32410633|ref|XP_325797.1| hypothetical protein [Neurospora cr... 99 8e-20
gi|18977943|ref|NP_579300.1| proteasome, subunit alpha (multicat... 99 1e-19
gi|46121975|ref|XP_385541.1| conserved hypothetical protein [Gib... 99 1e-19
gi|12229894|sp|O24733|PSMA_THEK1 Proteasome alpha subunit (Multi... 98 2e-19
gi|464458|sp|P34119|PSA4_DICDI Proteasome subunit alpha type 4 (... 97 4e-19
gi|50302437|ref|XP_451153.1| unnamed protein product [Kluyveromy... 97 4e-19
gi|50308239|ref|XP_454120.1| unnamed protein product [Kluyveromy... 97 4e-19
gi|14520823|ref|NP_126298.1| proteasome, subunit alpha [Pyrococc... 97 5e-19
gi|28195693|gb|AAO27765.1| proteasome subunit alpha 3 [Gasterost... 96 7e-19
gi|8744995|emb|CAB95217.1| proteasome subunit [Leishmania major] 96 9e-19
gi|14591336|ref|NP_143414.1| proteasome, alpha subunit [Pyrococc... 96 1e-18
gi|20093823|ref|NP_613670.1| Protease subunit of the proteasome ... 95 1e-18
gi|49088052|ref|XP_405894.1| conserved hypothetical protein [Asp... 95 1e-18
gi|45198836|ref|NP_985865.1| AFR318Wp [Eremothecium gossypii] >g... 94 3e-18
gi|37654720|gb|AAQ96654.1| proteasome alpha 4 subunit [Branchios... 93 6e-18
gi|46142155|ref|ZP_00147872.2| COG0638: 20S proteasome, alpha an... 93 7e-18
gi|20090630|ref|NP_616705.1| multicatalytic endopeptidase comple... 92 1e-17
gi|29246315|gb|EAA37916.1| GLP_105_6759_5881 [Giardia lamblia AT... 92 2e-17
gi|11498101|ref|NP_069326.1| proteasome, subunit alpha (psmA) [A... 92 2e-17
gi|48837583|ref|ZP_00294556.1| COG0638: 20S proteasome, alpha an... 91 2e-17
gi|14324522|dbj|BAB59449.1| proteasome alpha subunit [Thermoplas... 91 3e-17
gi|13541135|ref|NP_110823.1| Proteasome protease subunit alpha [... 91 3e-17
gi|45357814|ref|NP_987371.1| proteasome, subunit alpha [Methanoc... 91 3e-17
gi|29726314|pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome F... 91 3e-17
gi|2511588|emb|CAA74025.1| multicatalytic endopeptidase complex,... 90 6e-17
gi|3421070|gb|AAC32054.1| 20S proteasome subunit PAA1 [Arabidops... 90 6e-17
gi|15238554|ref|NP_198409.1| 20S proteasome alpha subunit A1 (PA... 90 6e-17
gi|46441895|gb|EAL01189.1| hypothetical protein CaO19.350 [Candi... 89 8e-17
gi|25143215|ref|NP_491520.2| proteasome Alpha Subunit (28.2 kD) ... 89 8e-17
gi|20260140|gb|AAM12968.1| multicatalytic endopeptidase complex ... 89 8e-17
gi|6093782|sp|Q59565|PSMA_METTE Proteasome alpha subunit (Multic... 89 1e-16
gi|50416403|ref|XP_457549.1| unnamed protein product [Debaryomyc... 89 1e-16
gi|1172601|sp|Q09682|PSA4_SCHPO Probable proteasome subunit alph... 89 1e-16
gi|11066269|gb|AAG28528.1| 20S proteasome alpha 3 subunit [Trypa... 89 1e-16
gi|16082284|ref|NP_394744.1| proteasome alpha subunit [Thermopla... 89 1e-16
gi|15668771|ref|NP_247571.1| proteasome, subunit alpha (psmA) [M... 89 1e-16
gi|31212145|ref|XP_315057.1| ENSANGP00000011441 [Anopheles gambi... 89 1e-16
gi|39583626|emb|CAE65730.1| Hypothetical protein CBG10813 [Caeno... 88 2e-16
gi|41615303|ref|NP_963801.1| NEQ521 [Nanoarchaeum equitans Kin4-... 88 2e-16
gi|21228722|ref|NP_634644.1| Proteasome, subunit-alpha [Methanos... 88 2e-16
gi|11967891|emb|CAC19494.1| maize 20S proteasome alpha subunit [... 88 2e-16
gi|48141210|ref|XP_397196.1| similar to Proteasome subunit alpha... 87 3e-16
gi|12229948|sp|Q9XG77|PSA6_TOBAC Proteasome subunit alpha type 6... 87 3e-16
gi|15224993|ref|NP_178641.1| 20S proteasome alpha subunit A2 (PA... 87 3e-16
gi|50548061|ref|XP_501500.1| hypothetical protein [Yarrowia lipo... 86 7e-16
gi|12229945|sp|Q9V2V5|PSM2_HALVO Proteasome alpha-2 subunit (Mul... 86 7e-16
gi|50257248|gb|EAL19957.1| hypothetical protein CNBF2840 [Crypto... 86 7e-16
gi|15897639|ref|NP_342244.1| Proteasome subunit [Sulfolobus solf... 86 7e-16
gi|12229922|sp|Q9LSU3|PSA6_ORYSA Proteasome subunit alpha type 6... 86 7e-16
gi|47230708|emb|CAF99901.1| unnamed protein product [Tetraodon n... 86 9e-16
gi|46226753|gb|EAK87732.1| proteasome subunit alpha type 4, NTN ... 86 9e-16
gi|542656|pir||S38530 C 3.4.25.1 proteasome endopeptidase comple... 86 9e-16
gi|47550827|ref|NP_999862.1| proteasome (prosome, macropain) sub... 86 9e-16
gi|15789479|ref|NP_279303.1| proteasome, subunit beta; PsmB [Hal... 86 1e-15
gi|29726321|pdb|1J2Q|A Chain A, 20s Proteasome In Complex With C... 85 2e-15
gi|50549081|ref|XP_502011.1| hypothetical protein [Yarrowia lipo... 84 3e-15
gi|29841012|gb|AAP06025.1| similar to NM_011967 proteasome (pros... 84 3e-15
gi|34783332|gb|AAH22817.2| PSMA4 protein [Homo sapiens] 84 3e-15
gi|8394069|ref|NP_058977.1| proteasome (prosome, macropain) subu... 84 3e-15
gi|50752781|ref|XP_413742.1| PREDICTED: similar to Proteasome su... 84 3e-15
gi|6755196|ref|NP_036096.1| proteasome (prosome, macropain) subu... 84 3e-15
gi|4506185|ref|NP_002780.1| proteasome alpha 4 subunit; proteaso... 84 3e-15
gi|50290521|ref|XP_447692.1| unnamed protein product [Candida gl... 84 3e-15
gi|7576250|emb|CAB87991.1| 20S proteasome alpha-subunit 3 (C9) [... 84 3e-15
gi|3114271|pdb|1RYP|C Chain C, Crystal Structure Of The 20s Prot... 84 4e-15
gi|11513993|pdb|1G0U|B Chain B, A Gated Channel Into The Proteas... 84 4e-15
gi|6321574|ref|NP_011651.1| 20S proteasome beta-type subunit; th... 84 4e-15
gi|50551999|ref|XP_503474.1| hypothetical protein [Yarrowia lipo... 83 6e-15
gi|46254536|gb|AAS86241.1| testes-specific alpha4-t1 proteasome ... 83 7e-15
gi|46254538|gb|AAS86242.1| testes-specific alpha4-t1 proteasome ... 83 7e-15
gi|34978952|gb|AAQ83685.1| proteasome subunit alpha-3 [Allium sa... 83 7e-15
gi|38649313|gb|AAH63170.1| Proteasome (prosome, macropain) subun... 83 7e-15
gi|46254496|gb|AAS86221.1| alpha4 proteasome subunit [Drosophila... 82 1e-14
gi|14601414|ref|NP_147951.1| proteasome , alpha subunit [Aeropyr... 82 1e-14
gi|12229897|sp|O48551|PSA6_SOYBN Proteasome subunit alpha type 6... 82 1e-14
gi|12229946|sp|Q9V2V6|PSM1_HALVO Proteasome alpha-1 subunit (Mul... 82 1e-14
gi|29248189|gb|EAA39729.1| GLP_14_13086_13730 [Giardia lamblia A... 82 1e-14
gi|46254462|gb|AAS86204.1| alpha4 proteasome subunit [Drosophila... 82 1e-14
gi|48852939|ref|ZP_00307121.1| COG0638: 20S proteasome, alpha an... 82 1e-14
gi|38051991|gb|AAH60576.1| Unknown (protein for MGC:72879) [Ratt... 82 2e-14
gi|4506181|ref|NP_002778.1| proteasome alpha 2 subunit; proteaso... 82 2e-14
gi|12850076|dbj|BAB28582.1| unnamed protein product [Mus musculus] 82 2e-14
gi|6679497|ref|NP_032970.1| proteasome (prosome, macropain) subu... 82 2e-14
gi|8394063|ref|NP_058975.1| proteasome (prosome, macropain) subu... 82 2e-14
gi|21465643|pdb|1IRU|B Chain B, Crystal Structure Of The Mammali... 82 2e-14
gi|48477876|ref|YP_023582.1| proteasome alpha subunit [Picrophil... 81 2e-14
gi|24651571|ref|NP_651843.1| CG1736-PA [Drosophila melanogaster]... 81 3e-14
gi|24850286|gb|AAN63094.1| testis-specific 20S proteasome subuni... 81 3e-14
gi|18313186|ref|NP_559853.1| proteasome alpha subunit [Pyrobacul... 81 3e-14
gi|50733010|ref|XP_418868.1| PREDICTED: similar to Proteasome su... 80 4e-14
gi|50289853|ref|XP_447358.1| unnamed protein product [Candida gl... 80 4e-14
gi|85119|pir||JQ0681 proteasome chain 1 - fruit fly (Drosophila ... 80 4e-14
gi|17933602|ref|NP_525092.1| CG3422-PA [Drosophila melanogaster]... 80 4e-14
gi|11513995|pdb|1G0U|D Chain D, A Gated Channel Into The Proteas... 80 4e-14
gi|50748430|ref|XP_421242.1| PREDICTED: similar to Proteasome su... 80 4e-14
gi|12229911|sp|Q27562|PSA1_DICDI Proteasome subunit alpha type 1... 80 5e-14
gi|23619460|ref|NP_705422.1| proteasome subunit, putative [Plasm... 80 5e-14
gi|46433106|gb|EAK92560.1| hypothetical protein CaO19.709 [Candi... 80 5e-14
gi|15219317|ref|NP_178042.1| 20S proteasome alpha subunit B, put... 80 6e-14
gi|17508493|ref|NP_492765.1| proteasome Alpha Subunit (27.2 kD) ... 80 6e-14
gi|50284725|ref|XP_444790.1| unnamed protein product [Candida gl... 80 6e-14
gi|30140329|emb|CAD89602.1| putative proteasome subunit [Candida... 80 6e-14
gi|15219257|ref|NP_173096.1| 20S proteasome alpha subunit B (PAB... 79 8e-14
gi|15920658|ref|NP_376327.1| 235aa long hypothetical proteasome ... 79 8e-14
gi|46229819|gb|EAK90637.1| proteasome subunit alpha2, protease o... 79 8e-14
gi|21362819|sp|Q975G5|PSMA_SULTO Proteasome alpha subunit (Multi... 79 8e-14
gi|32405630|ref|XP_323428.1| hypothetical protein [Neurospora cr... 79 8e-14
gi|12229889|sp|O16811|PS71_DROVI Proteasome subunit alpha type 7... 79 1e-13
gi|130852|sp|P24495|PSA2_XENLA Proteasome subunit alpha type 2 (... 79 1e-13
gi|45190899|ref|NP_985153.1| AER296Wp [Eremothecium gossypii] >g... 79 1e-13
gi|17562790|ref|NP_505750.1| proteasome Alpha Subunit (25.3 kD) ... 79 1e-13
gi|38102685|gb|EAA49495.1| hypothetical protein MG01153.4 [Magna... 79 1e-13
gi|45360875|ref|NP_989113.1| proteasome (prosome, macropain) sub... 79 1e-13
gi|37747972|gb|AAH59539.1| Psma2 protein [Danio rerio] 79 1e-13
gi|1709758|sp|P52428|PSA1_ORYSA Proteasome subunit alpha type 1 ... 79 1e-13
gi|49079186|ref|XP_403267.1| hypothetical protein UM05652.1 [Ust... 78 2e-13
gi|6093780|sp|O73672|PSA2_CARAU Proteasome subunit alpha type 2 ... 78 2e-13
gi|50302577|ref|XP_451224.1| unnamed protein product [Kluyveromy... 78 2e-13
gi|23486739|gb|EAA20882.1| Proteasome A-type and B-type, putativ... 78 2e-13
gi|18152451|emb|CAC82813.1| proteasome subunit alpha5 [Trypanoso... 78 2e-13
gi|39593417|emb|CAE64887.1| Hypothetical protein CBG09700 [Caeno... 78 2e-13
gi|46254570|gb|AAS86258.1| testes-specific alpha4-t1 proteasome ... 78 2e-13
gi|312258|emb|CAA46111.1| PUP2 [Saccharomyces cerevisiae] 78 2e-13
gi|27525440|emb|CAD47833.1| 20S proteasome alpha 5 subunit [Cera... 78 2e-13
gi|1041976|gb|AAB34631.1| Doa5, PUP2=alpha-type proteasome subun... 78 2e-13
gi|6755198|ref|NP_036098.1| proteasome (prosome, macropain) subu... 78 2e-13
gi|46254562|gb|AAS86254.1| testes-specific alpha4-t1 proteasome ... 77 3e-13
gi|46254564|gb|AAS86255.1| testes-specific alpha4-t1 proteasome ... 77 3e-13
gi|46254566|gb|AAS86256.1| testes-specific alpha4-t1 proteasome ... 77 3e-13
gi|18859267|ref|NP_571870.1| proteasome (prosome, macropain) sub... 77 3e-13
gi|19168518|emb|CAC94781.1| PROSAg25 protein [Anopheles gambiae] 77 3e-13
gi|6321692|ref|NP_011769.1| Proteasome subunit; Pup2p [Saccharom... 77 3e-13
gi|31241267|ref|XP_321064.1| ENSANGP00000011336 [Anopheles gambi... 77 3e-13
gi|49098619|ref|XP_410684.1| hypothetical protein AN6547.2 [Aspe... 77 3e-13
gi|15220961|ref|NP_175788.1| 20S proteasome alpha subunit E1 (PA... 77 3e-13
gi|50427903|ref|XP_462564.1| unnamed protein product [Debaryomyc... 77 3e-13
gi|8394076|ref|NP_058979.1| proteasome (prosome, macropain) subu... 77 3e-13
gi|50540244|ref|NP_001002589.1| zgc:92716 [Danio rerio] >gnl|BL_... 77 3e-13
gi|50302571|ref|XP_451221.1| unnamed protein product [Kluyveromy... 77 3e-13
gi|27503801|gb|AAH42820.1| MGC26605 protein [Homo sapiens] 77 4e-13
gi|19112166|ref|NP_595374.1| 20S proteasome component (alpha 1) ... 77 4e-13
gi|17136420|ref|NP_476691.1| CG9327-PA [Drosophila melanogaster]... 77 4e-13
gi|103322|pir||S10318 C 3.4.25.1 proteasome endopeptidase comple... 77 4e-13
gi|15231824|ref|NP_188046.1| 20S proteasome alpha subunit E2 (PA... 77 4e-13
gi|12229920|sp|Q9LSU1|PSA5_ORYSA Proteasome subunit alpha type 5... 77 4e-13
gi|50603942|gb|AAH77442.1| Unknown (protein for MGC:82289) [Xeno... 77 4e-13
gi|47085943|ref|NP_998331.1| zgc:77139 [Danio rerio] >gnl|BL_ORD... 77 5e-13
gi|6321427|ref|NP_011504.1| Proteasome subunit YC7alpha/Y8 (prot... 77 5e-13
gi|47228214|emb|CAG07609.1| unnamed protein product [Tetraodon n... 77 5e-13
gi|39644890|gb|AAH02900.2| PSMA2 protein [Homo sapiens] 77 5e-13
gi|41352543|gb|AAS01024.1| proteasome alpha subunit [Ornithodoro... 77 5e-13
gi|46137479|ref|XP_390431.1| conserved hypothetical protein [Gib... 77 5e-13
gi|3114269|pdb|1RYP|A Chain A, Crystal Structure Of The 20s Prot... 77 5e-13
gi|12229928|sp|Q9PTW9|PSA7_CARAU Proteasome subunit alpha type 7... 76 7e-13
gi|12229929|sp|Q9PVQ1|PS72_XENLA Proteasome subunit alpha type 7... 76 7e-13
gi|19115284|ref|NP_594372.1| proteasome component PUP2 homolog [... 76 7e-13
gi|49117797|gb|AAH72719.1| Unknown (protein for MGC:91778) [Dani... 76 7e-13
gi|45360795|ref|NP_989071.1| hypothetical protein MGC75728 [Xeno... 76 7e-13
gi|7106389|ref|NP_036099.1| proteasome (prosome, macropain) subu... 76 7e-13
gi|12229939|sp|Q9U793|PSA2_TRYBB Proteasome subunit alpha type 2... 76 7e-13
gi|17508491|ref|NP_492360.1| proteasome Alpha Subunit (28.2 kD) ... 76 7e-13
gi|47222687|emb|CAG00121.1| unnamed protein product [Tetraodon n... 76 7e-13
gi|22947842|gb|AAN07899.1| 20S proteasome alpha 6 subunit [Nicot... 76 9e-13
gi|34870100|ref|XP_212707.2| similar to Proteasome subunit alpha... 76 9e-13
gi|12229916|sp|Q94561|PSA5_ENTHI Proteasome subunit alpha type 5... 76 9e-13
gi|7530130|emb|CAB86711.1| 20S proteasome alpha 5 subunit [Leish... 76 9e-13
gi|17737927|ref|NP_524328.1| CG5266-PA [Drosophila melanogaster]... 76 9e-13
gi|45382931|ref|NP_989944.1| proteasome 28 kDa subunit homolog [... 76 9e-13
gi|33416349|gb|AAH55520.1| Unknown (protein for MGC:66161) [Dani... 76 9e-13
gi|49387541|dbj|BAD25097.1| alpha 2 subunit of 20S proteasome [O... 75 1e-12
gi|12229921|sp|Q9LSU2|PSA2_ORYSA Proteasome subunit alpha type 2... 75 1e-12
gi|31212975|ref|XP_315431.1| ENSANGP00000007022 [Anopheles gambi... 75 1e-12
gi|12229925|sp|Q9NDA2|PSA7_TRYBB Proteasome subunit alpha type 7... 75 2e-12
gi|21537234|gb|AAM61575.1| 20S proteasome subunit PAF1 [Arabidop... 75 2e-12
gi|15239061|ref|NP_199093.1| 20S proteasome alpha subunit F1 (PA... 75 2e-12
gi|25290066|pir||T51974 C 3.4.25.1 proteasome endopeptidase comp... 75 2e-12
gi|34860906|ref|XP_342599.1| proteasome (prosome, macropain) sub... 75 2e-12
gi|4506189|ref|NP_002783.1| proteasome alpha 7 subunit isoform 1... 75 2e-12
gi|30583771|gb|AAP36134.1| Homo sapiens proteasome (prosome, mac... 75 2e-12
gi|39580819|emb|CAE58988.1| Hypothetical protein CBG02261 [Caeno... 75 2e-12
gi|24119230|ref|NP_705941.1| proteasome (prosome, macropain) sub... 75 2e-12
gi|39589722|emb|CAE66957.1| Hypothetical protein CBG12349 [Caeno... 75 2e-12
gi|23489884|gb|EAA21789.1| Y13180 multicatalytic endopeptidase [... 75 2e-12
gi|3114273|pdb|1RYP|E Chain E, Crystal Structure Of The 20s Prot... 75 2e-12
gi|12229923|sp|Q9M4T8|PSA5_SOYBN Proteasome subunit alpha type 5... 75 2e-12
gi|12229950|sp|Q9XZG5|PSA5_TRYBB Proteasome subunit alpha type 5... 75 2e-12
gi|15220151|ref|NP_175158.1| 20S proteasome alpha subunit F2 (PA... 74 3e-12
gi|38083795|ref|XP_357002.1| RIKEN cDNA 2410072D24 [Mus musculus... 74 3e-12
gi|46439482|gb|EAK98799.1| hypothetical protein CaO19.5378 [Cand... 74 3e-12
gi|46439381|gb|EAK98699.1| hypothetical protein CaO19.12833 [Can... 74 3e-12
gi|4092058|gb|AAC99402.1| proteasome subunit HSPC [Homo sapiens] 74 3e-12
gi|12229908|sp|O96788|PSA1_TRYBR Proteasome subunit alpha type 1... 74 3e-12
gi|23619461|ref|NP_705423.1| proteasome subunit, putative [Plasm... 74 3e-12
gi|47224863|emb|CAG06433.1| unnamed protein product [Tetraodon n... 74 3e-12
gi|23489885|gb|EAA21790.1| proteasome subunit alpha type 4 [Plas... 74 3e-12
gi|50546813|ref|XP_500876.1| hypothetical protein [Yarrowia lipo... 74 5e-12
gi|46254558|gb|AAS86252.1| testes-specific alpha4-t1 proteasome ... 74 5e-12
gi|49097098|ref|XP_410009.1| conserved hypothetical protein [Asp... 74 5e-12
gi|49080726|ref|XP_403849.1| hypothetical protein UM06234.1 [Ust... 74 5e-12
gi|50260035|gb|EAL22698.1| hypothetical protein CNBB1470 [Crypto... 73 6e-12
gi|21356137|ref|NP_650910.1| CG17268-PA [Drosophila melanogaster... 73 6e-12
gi|7435880|pir||S72226 C 3.4.25.1 proteasome endopeptidase compl... 73 6e-12
gi|50427307|ref|XP_462266.1| unnamed protein product [Debaryomyc... 73 8e-12
gi|14594923|emb|CAC43322.1| putative alpha6 proteasome subunit [... 73 8e-12
gi|48142173|ref|XP_393583.1| similar to ENSANGP00000007022 [Apis... 73 8e-12
gi|31230444|ref|XP_318387.1| ENSANGP00000015960 [Anopheles gambi... 73 8e-12
gi|46123563|ref|XP_386335.1| conserved hypothetical protein [Gib... 73 8e-12
gi|19115013|ref|NP_594101.1| proteasome subunit C2 [Schizosaccha... 73 8e-12
gi|5814087|gb|AAD52094.1| 20S proteasome alpha subunit [Leishman... 72 1e-11
gi|1857239|gb|AAB48403.1| 29 kDa proteasome subunit TCPR29A [Try... 72 1e-11
gi|12643703|sp|P92188|PSA1_TRYCR Proteasome subunit alpha type 1... 72 1e-11
gi|49117267|ref|XP_412191.1| conserved hypothetical protein [Asp... 72 1e-11
gi|49080054|ref|XP_403601.1| hypothetical protein UM05986.1 [Ust... 72 1e-11
gi|48128110|ref|XP_393294.1| similar to PROSAg25 protein [Apis m... 72 1e-11
gi|50260142|gb|EAL22803.1| hypothetical protein CNBB0240 [Crypto... 72 1e-11
gi|7435868|pir||T02089 proteasome chain - rice >gnl|BL_ORD_ID|19... 72 1e-11
gi|50260207|gb|EAL22868.1| hypothetical protein CNBB0890 [Crypto... 72 1e-11
gi|32411629|ref|XP_326295.1| hypothetical protein [Neurospora cr... 72 1e-11
gi|50555329|ref|XP_505073.1| hypothetical protein [Yarrowia lipo... 72 2e-11
gi|88168|pir||S17521 C 3.4.25.1 proteasome endopeptidase complex... 72 2e-11
gi|7106387|ref|NP_036097.1| proteasome (prosome, macropain) subu... 72 2e-11
gi|50255130|gb|EAL17869.1| hypothetical protein CNBL1310 [Crypto... 72 2e-11
gi|38111157|gb|EAA56775.1| hypothetical protein MG07130.4 [Magna... 72 2e-11
gi|50407398|ref|XP_456708.1| unnamed protein product [Debaryomyc... 71 2e-11
gi|49118346|gb|AAH73346.1| Unknown (protein for MGC:80760) [Xeno... 71 2e-11
gi|21389549|ref|NP_653263.1| hypothetical protein MGC26605 [Homo... 71 2e-11
gi|18447104|gb|AAL68143.1| AT30052p [Drosophila melanogaster] 71 2e-11
gi|23612640|ref|NP_704201.1| proteasome subunit alpha type 5, pu... 71 2e-11
gi|26006840|sp|Q8TAA3|PS7L_HUMAN Proteasome subunit alpha type 7... 71 2e-11
gi|38110838|gb|EAA56501.1| hypothetical protein MG06472.4 [Magna... 71 2e-11
gi|16943777|emb|CAD10778.1| 20S proteasome subunit alpha V [Phys... 71 2e-11
gi|46121687|ref|XP_385398.1| conserved hypothetical protein [Gib... 71 2e-11
gi|17562788|ref|NP_506571.1| proteasome Alpha Subunit (27.0 kD) ... 71 2e-11
gi|37778980|gb|AAP20150.1| alpha 4 subunit of 20S proteasome [Pa... 71 2e-11
gi|46254510|gb|AAS86228.1| testes-specific alpha4-t2 proteasome ... 71 3e-11
gi|46254534|gb|AAS86240.1| testes-specific alpha4-t2 proteasome ... 71 3e-11
gi|19528159|gb|AAL90194.1| AT26889p [Drosophila melanogaster] 71 3e-11
gi|46254528|gb|AAS86237.1| testes-specific alpha4-t2 proteasome ... 71 3e-11
gi|19922898|ref|NP_611920.1| CG4569-PA [Drosophila melanogaster]... 71 3e-11
gi|7435879|pir||S72225 C 3.4.25.1 proteasome endopeptidase compl... 71 3e-11
gi|49095090|ref|XP_409006.1| conserved hypothetical protein [Asp... 71 3e-11
gi|2511586|emb|CAA73625.1| multicatalytic endopeptidase [Arabido... 70 4e-11
gi|47227266|emb|CAF96815.1| unnamed protein product [Tetraodon n... 70 4e-11
gi|45201007|ref|NP_986577.1| AGL089Wp [Eremothecium gossypii] >g... 70 4e-11
gi|38103615|gb|EAA50294.1| hypothetical protein MG04053.4 [Magna... 70 5e-11
gi|34878218|ref|XP_344650.1| similar to Proteasome subunit alpha... 70 5e-11
gi|46254502|gb|AAS86224.1| testes-specific alpha4-t2 proteasome ... 70 5e-11
gi|45187518|ref|NP_983741.1| ADL354Wp [Eremothecium gossypii] >g... 70 5e-11
gi|7435867|pir||T01036 hypothetical protein YUP8H12R.19 - Arabid... 70 5e-11
gi|12229936|sp|Q9SXU1|PSA7_CICAR Proteasome subunit alpha type 7... 70 5e-11
gi|32413036|ref|XP_326998.1| hypothetical protein [Neurospora cr... 70 5e-11
gi|46227998|gb|EAK88918.1| putative proteasome regulatory subuni... 70 5e-11
gi|39589905|emb|CAE60903.1| Hypothetical protein CBG04619 [Caeno... 70 5e-11
gi|45387823|ref|NP_991271.1| proteasome subunit, alpha type, 5 [... 70 7e-11
gi|6562661|emb|CAB62817.1| 20S proteasome alpha 2 subunit [Leish... 70 7e-11
gi|32408341|ref|XP_324652.1| hypothetical protein [Neurospora cr... 70 7e-11
gi|21465646|pdb|1IRU|E Chain E, Crystal Structure Of The Mammali... 69 9e-11
gi|3334299|sp|O24030|PSA7_LYCES Proteasome subunit alpha type 7 ... 69 9e-11
gi|3228662|gb|AAC23597.1| proteasome A type subunit [Cryptospori... 69 9e-11
gi|29248522|gb|EAA40054.1| GLP_387_56144_56881 [Giardia lamblia ... 69 9e-11
gi|1346784|sp|P48004|PSA7_RAT Proteasome subunit alpha type 7 (P... 69 9e-11
gi|46227993|gb|EAK88913.1| proteasome subunit alpha type 1, NTN ... 69 9e-11
gi|50307089|ref|XP_453523.1| unnamed protein product [Kluyveromy... 69 1e-10
gi|30580480|sp|Q8X077|PSA2_NEUCR Probable proteasome subunit alp... 69 1e-10
gi|50258402|gb|EAL21091.1| hypothetical protein CNBD4670 [Crypto... 69 1e-10
gi|15230435|ref|NP_190694.1| 20S proteasome alpha subunit D (PAD... 69 1e-10
gi|464459|sp|P34120|PSA7_DICDI Proteasome subunit alpha type 7 (... 68 2e-10
gi|8394072|ref|NP_058978.1| proteasome (prosome, macropain) subu... 68 2e-10
gi|50548937|ref|XP_501939.1| hypothetical protein [Yarrowia lipo... 68 2e-10
gi|19111957|ref|NP_595165.1| proteasome component; PROS28 family... 68 2e-10
gi|50807165|ref|XP_424548.1| PREDICTED: similar to zeta proteaso... 68 2e-10
gi|46436840|gb|EAK96196.1| hypothetical protein CaO19.7178 [Cand... 68 2e-10
gi|50287193|ref|XP_446026.1| unnamed protein product [Candida gl... 68 2e-10
gi|49079278|ref|XP_403302.1| hypothetical protein UM05687.1 [Ust... 68 2e-10
gi|29247707|gb|EAA39261.1| GLP_457_25625_26368 [Giardia lamblia ... 67 3e-10
gi|23490901|gb|EAA22562.1| proteasome subunit alpha type 2 [Plas... 67 3e-10
gi|21593040|gb|AAM64989.1| multicatalytic endopeptidase complex ... 67 3e-10
gi|6324535|ref|NP_014604.1| 20S proteasome alpha-type subunit; P... 67 3e-10
gi|11513994|pdb|1G0U|C Chain C, A Gated Channel Into The Proteas... 67 3e-10
gi|28828056|gb|AAO50739.1| similar to Dictyostelium discoideum (... 67 4e-10
gi|50289341|ref|XP_447101.1| unnamed protein product [Candida gl... 67 4e-10
gi|23612167|ref|NP_703747.1| proteasome subunit alpha type 2, pu... 67 4e-10
gi|3114272|pdb|1RYP|D Chain D, Crystal Structure Of The 20s Prot... 67 4e-10
gi|6323547|ref|NP_013618.1| 20S proteasome beta-type subunit; Pr... 67 6e-10
gi|39594670|emb|CAE72249.1| Hypothetical protein CBG19367 [Caeno... 67 6e-10
gi|19173153|ref|NP_596956.1| PROTEASOME REGULATORY SUBUNIT 8 [En... 66 7e-10
gi|12054744|emb|CAC20614.1| promastigote alpha-2 subunit [Leishm... 66 7e-10
gi|2511580|emb|CAA73622.1| multicatalytic endopeptidase [Arabido... 66 9e-10
gi|15239271|ref|NP_201415.1| 20S proteasome alpha subunit D2 (PA... 66 9e-10
gi|23489205|gb|EAA21516.1| proteasome subunit alpha type 5 [Plas... 66 9e-10
gi|39593140|emb|CAE64609.1| Hypothetical protein CBG09365 [Caeno... 65 1e-09
gi|7435885|pir||T04300 probable C 3.4.25.1 proteasome endopeptid... 65 1e-09
gi|19921232|ref|NP_609623.1| CG5648-PA [Drosophila melanogaster]... 65 1e-09
gi|49100393|ref|XP_410863.1| PSA2_NEUCR Probable proteasome subu... 65 2e-09
gi|38074730|ref|XP_135563.2| similar to Proteasome subunit alpha... 65 2e-09
gi|17562792|ref|NP_504472.1| proteasome Alpha Subunit (28.3 kD) ... 65 2e-09
gi|30038118|gb|AAP12722.1| pros28.1B [Drosophila americana] 65 2e-09
gi|30266133|gb|AAP21576.1| pros28.1B [Drosophila novamexicana] 65 2e-09
gi|46117136|ref|XP_384586.1| PSA2_NEUCR Probable proteasome subu... 64 3e-09
gi|31211921|ref|XP_314945.1| ENSANGP00000019329 [Anopheles gambi... 64 3e-09
gi|38047741|gb|AAR09773.1| similar to Drosophila melanogaster Pr... 64 4e-09
gi|24586400|ref|NP_724614.1| CG18495-PA [Drosophila melanogaster... 64 5e-09
gi|19075820|ref|NP_588320.1| 20s proteasome component C3 [Schizo... 64 5e-09
gi|45184835|ref|NP_982553.1| AAR012Cp [Eremothecium gossypii] >g... 63 6e-09
gi|46228400|gb|EAK89299.1| proteasome subunit alpha1 [Cryptospor... 63 8e-09
gi|4929308|gb|AAD33944.1| 20S proteasome subunit alpha1 [Drosoph... 63 8e-09
gi|50726607|dbj|BAD34241.1| Proteasome subunit alpha type 7 [Ory... 63 8e-09
gi|50304213|ref|XP_452056.1| unnamed protein product [Kluyveromy... 63 8e-09
gi|47199693|emb|CAF87652.1| unnamed protein product [Tetraodon n... 62 1e-08
gi|38048537|gb|AAR10171.1| similar to Drosophila melanogaster Pr... 61 2e-08
gi|24654389|ref|NP_725669.1| CG10938-PA [Drosophila melanogaster... 61 3e-08
gi|172546|gb|AAA35020.1| scll+ suppressor protein 60 4e-08
gi|12229890|sp|O16812|PS73_DROVI Proteasome subunit alpha type 7... 60 5e-08
gi|50405657|ref|XP_456467.1| unnamed protein product [Debaryomyc... 60 5e-08
gi|23509938|ref|NP_702605.1| Proteosome subunit alpha type 1, pu... 60 5e-08
gi|46397024|sp|Q9GU37|PSA1_TRYBB Proteasome subunit alpha type 1... 60 5e-08
gi|1498589|gb|AAB93421.1| 20S proteasome alpha subunit PSMA5 [Dr... 60 5e-08
gi|29247155|gb|EAA38727.1| GLP_436_20835_20083 [Giardia lamblia ... 60 5e-08
gi|12644044|sp|O04861|PSA7_ORYSA Proteasome subunit alpha type 7... 60 7e-08
gi|3641499|gb|AAC36462.1| proteosome component [Theileria parva] 60 7e-08
gi|47220588|emb|CAG05614.1| unnamed protein product [Tetraodon n... 59 9e-08
gi|23110935|ref|NP_683877.1| proteasome alpha 1 subunit isoform ... 59 1e-07
gi|30584967|gb|AAP36756.1| Homo sapiens proteasome (prosome, mac... 59 1e-07
gi|13543551|gb|AAH05932.1| Proteasome alpha 1 subunit, isoform 2... 59 1e-07
gi|4506179|ref|NP_002777.1| proteasome alpha 1 subunit isoform 2... 59 1e-07
gi|45384316|ref|NP_990351.1| 20S proteasome subunit C2 [Gallus g... 59 2e-07
gi|31236614|ref|XP_319444.1| ENSANGP00000014428 [Anopheles gambi... 58 2e-07
gi|33563282|ref|NP_036095.1| proteasome (prosome, macropain) sub... 58 2e-07
gi|46438138|gb|EAK97474.1| hypothetical protein CaO19.7335 [Cand... 58 3e-07
gi|50295084|ref|XP_449953.1| unnamed protein product [Candida gl... 58 3e-07
gi|33604016|gb|AAH56249.1| PSMA4 protein [Homo sapiens] 57 3e-07
gi|20306890|gb|AAH28371.1| MGC26605 protein [Homo sapiens] >gnl|... 57 3e-07
gi|46125809|ref|XP_387458.1| conserved hypothetical protein [Gib... 57 3e-07
gi|50303013|ref|XP_451444.1| unnamed protein product [Kluyveromy... 57 3e-07
gi|19263493|gb|AAH25393.1| MGC26605 protein [Homo sapiens] 57 3e-07
gi|23479087|gb|EAA16012.1| proteasome subunit alpha Type 6-B [Pl... 57 4e-07
gi|8394060|ref|NP_058974.1| proteasome (prosome, macropain) subu... 57 4e-07
gi|39722370|emb|CAE84406.1| Pre5 protein [Kluyveromyces delphensis] 57 4e-07
gi|50369319|gb|AAH76206.1| Unknown (protein for MGC:92726) [Dani... 57 4e-07
gi|29247195|gb|EAA38766.1| GLP_47_22543_21776 [Giardia lamblia A... 56 1e-06
gi|3114274|pdb|1RYP|F Chain F, Crystal Structure Of The 20s Prot... 55 1e-06
gi|6323974|ref|NP_014045.1| 20S proteasome alpha-type subunit; P... 55 1e-06
gi|11513996|pdb|1G0U|E Chain E, A Gated Channel Into The Proteas... 55 1e-06
gi|23110948|ref|NP_689468.1| proteasome alpha 7 subunit isoform ... 55 2e-06
gi|190447|gb|AAA92734.1| prosomal protein P30-33K 55 2e-06
gi|296736|emb|CAA43964.1| macropain subunit iota [Homo sapiens] 54 5e-06
gi|13812023|ref|NP_113154.1| 26S proteasome SU [Guillardia theta... 54 5e-06
gi|14039743|gb|AAK53380.1| 20S proteasome subunit alpha 3 [Loliu... 54 5e-06
gi|45200761|ref|NP_986331.1| AGL336Wp [Eremothecium gossypii] >g... 53 6e-06
gi|17737405|ref|NP_523532.1| CG4904-PA [Drosophila melanogaster]... 53 6e-06
gi|17945494|gb|AAL48800.1| RE23081p [Drosophila melanogaster] 53 6e-06
gi|19173680|ref|NP_597483.1| 26S PROTEASOME ZETA CHAIN [Encephal... 52 1e-05
gi|38047901|gb|AAR09853.1| similar to Drosophila melanogaster Pr... 52 1e-05
gi|41052611|dbj|BAD08003.1| putative Proteasome subunit alpha ty... 52 2e-05
gi|26353732|dbj|BAC40496.1| unnamed protein product [Mus musculus] 52 2e-05
gi|15022420|dbj|BAB62241.1| alpha 1-2 subunit of 20S proteasome ... 51 2e-05
gi|47189108|emb|CAF93649.1| unnamed protein product [Tetraodon n... 51 2e-05
gi|47190541|emb|CAF94828.1| unnamed protein product [Tetraodon n... 51 2e-05
gi|19074527|ref|NP_586033.1| 26S PROTEASOME SUBUNIT ALPHA-4 [Enc... 50 4e-05
gi|1907268|emb|CAA62960.1| proteasome subunit C9-like protein [S... 50 5e-05
gi|12584835|gb|AAG59850.1| 20S proteasome alpha subunit 4 [Giard... 50 5e-05
gi|2134191|pir||S64739 C 3.4.25.1 proteasome endopeptidase compl... 49 2e-04
gi|19173674|ref|NP_597477.1| 26S PROTEASOME ALPHA-TYPE SUBUNIT C... 48 2e-04
gi|49078688|ref|XP_403072.1| hypothetical protein UM05457.1 [Ust... 48 3e-04
gi|13812088|ref|NP_113179.1| 26S proteasome SU alpha7 [Guillardi... 48 3e-04
gi|23612939|ref|NP_704478.1| proteasome subunit alpha, putative ... 47 6e-04
gi|9623020|gb|AAF90007.1| 20S proteasome alpha 3 subunit [Acanth... 46 8e-04
gi|26343477|dbj|BAC35395.1| unnamed protein product [Mus musculus] 45 0.002
gi|34365414|emb|CAE46046.1| hypothetical protein [Homo sapiens] 45 0.002
gi|23490442|gb|EAA22218.1| proteasome subunit alpha type 1 [Plas... 45 0.002
gi|13812150|ref|NP_113277.1| similar to proteasome A-type submit... 43 0.007
gi|6942059|gb|AAF32307.1| 20S proteasome alpha subunit 7 [Giardi... 43 0.007
gi|6942053|gb|AAF32304.1| 20S proteasome alpha subunit 3 [Giardi... 42 0.011
gi|50424757|ref|XP_460968.1| unnamed protein product [Debaryomyc... 42 0.019
gi|32413140|ref|XP_327050.1| hypothetical protein [Neurospora cr... 39 0.16
gi|19074664|ref|NP_586170.1| PROTEASOME ALPHA SUBUNIT C6 [Enceph... 37 0.36
gi|47224035|emb|CAG12864.1| unnamed protein product [Tetraodon n... 37 0.61
gi|38111195|gb|EAA56810.1| hypothetical protein MG07165.4 [Magna... 36 1.0
gi|42820680|emb|CAF31993.1| adenylyl cyclase-associated protein,... 34 4.0
gi|15233569|ref|NP_194671.1| F-box family protein [Arabidopsis t... 33 6.8
gi|26450298|dbj|BAC42265.1| unknown protein [Arabidopsis thaliana] 33 6.8
gi|12314029|emb|CAC04018.1| dJ1005F21.4.2 (proteasome (prosome, ... 33 6.8
gi|38639974|ref|NP_943929.1| hypothetical protein Aeh1p051 [Bact... 33 6.8
gi|13812228|ref|NP_113359.1| 26s proteasome SU A6 [Guillardia th... 33 6.8
gi|15232160|ref|NP_186817.1| expressed protein [Arabidopsis thal... 33 8.9
>gi|17535355|ref|NP_496177.1| proteasome Alpha Subunit (28.9 kD)
(pas-7) [Caenorhabditis elegans]
gi|1172600|sp|Q09583|PSA3_CAEEL Proteasome subunit alpha type 3
(Proteasome subunit alpha 7)
gi|7511433|pir||T28119 hypothetical protein ZK945.2 -
Caenorhabditis elegans
Length = 260
Score = 468 bits (1203), Expect = e-131
Identities = 235/260 (90%), Positives = 235/260 (90%)
Frame = -1
Query: 783 MSSIGTGYDLAASTFSPDGRIFQVEYAQKAVDNAGTMIAIRGKNGVVVVADKLISSKLYT 604
MSSIGTGYDLAASTFSPDGRIFQVEYAQKAVDNAGTMIAIRGKNGVVVVADKLISSKLYT
Sbjct: 1 MSSIGTGYDLAASTFSPDGRIFQVEYAQKAVDNAGTMIAIRGKNGVVVVADKLISSKLYT 60
Query: 603 DNANPRMFXXXXXXXXXXXXNYPDGFALKNYAYGEAMKWLKDYREPMPIQNIANSVAEYI 424
DNANPRMF NYPDGFALKNYAYGEAMKWLKDYREPMPIQNIANSVAEYI
Sbjct: 61 DNANPRMFNVNDNVGVAVAGNYPDGFALKNYAYGEAMKWLKDYREPMPIQNIANSVAEYI 120
Query: 423 HIHTLGISRPFGAGAFFMSWNKQTGGRLFLVEPSGLNYEYKAWAVGKHRQXXXXXXXXXX 244
HIHTLGISRPFGAGAFFMSWNKQTGGRLFLVEPSGLNYEYKAWAVGKHRQ
Sbjct: 121 HIHTLGISRPFGAGAFFMSWNKQTGGRLFLVEPSGLNYEYKAWAVGKHRQAAKAEIEKLK 180
Query: 243 XXXLDVNQLVKEAARIIMVVRDENKDKNVQIEMGWVGEQTNGKYEEVPSEVVTAAEEWAI 64
LDVNQLVKEAARIIMVVRDENKDKNVQIEMGWVGEQTNGKYEEVPSEVVTAAEEWAI
Sbjct: 181 IEELDVNQLVKEAARIIMVVRDENKDKNVQIEMGWVGEQTNGKYEEVPSEVVTAAEEWAI 240
Query: 63 ASLTRTTWTIESFSCIYSHF 4
ASLTRTTWTIESFSCIYSHF
Sbjct: 241 ASLTRTTWTIESFSCIYSHF 260