Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm1/seq/B0252.2
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  B0252.2  CE30230   Spingomyelin phosphodiesterase status:Partially_confirmed TR:Q10916 protein_id:AAC46756.2

Scores for sequence family classification (score includes all domains):
Model       Description                                 Score    E-value  N
--------    -----------                                 -----    ------- ---
Metallophos Calcineurin-like phosphoesterase             70.8    1.1e-17   1
APG9        Autophagy protein Apg9                        3.9          2   1

Parsed for domains:
Model       Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------    ------- ----- -----    ----- -----      -----  -------
Metallophos   1/1     158   419 ..     1   124 []    70.8  1.1e-17
APG9          1/1     501   516 ..     1    16 [.     3.9        2

Alignments of top-scoring domains:
Metallophos: domain 1 of 1, from 158 to 419: score 70.8, E = 1.1e-17
                   *->mrilvigDlHggfedl...............................
                      + +l+++DlH +fe+  +++ + +++   + + +++++  +  ++ +
     B0252.2   158    LNVLQLTDLHVDFEYKypseancddpvccrvsvsepkkaagywgsvg 204

                   ..........llllela.e.kpdlvlflGDlvdrgppslevllll.....
                   + + +  + ++ l ++++ + +d+v+ +GD++++ +++   ++ l+  ++
     B0252.2   205 kcdipfwtveNMLSHINkThMIDMVIMTGDYINHVDWEYSIEEHLsvlrk 254

                   ...falklkapgpvylvrGNHDfdsgnsvy....................
                    ++++++  +  p+y+++GNH+  ++ns+++++ +  +++ + ++ +
     B0252.2   255 lhrLVQNTFPSTPIYWALGNHEGVPVNSFAphsvderfwptwlykefqtm 304

                   ..................................................
                   ++++ + + +++  + ++++    ++ +    + ++    +++ + + ++
     B0252.2   305 sgpwlsegakdsllkrgsystqvmdglklitlntgfcevtnfflylnqsd 354

                   ..welfleef.lllla.lvdgkillvHgglspd...........leellk
                   ++  + +++++l + +++++ +++l+H ++ +++  +++  +    +  +
     B0252.2   355 pdSSMSWFVKeLFESEkKGEQVYVLAHIPPGDSeclegwafnyyRVIQRF 404

                   .ngvdlvirGHtH.p<-*
                   +  + + ++GH+H +
     B0252.2   405 sSTIAAQFFGHDHlD    419

APG9: domain 1 of 1, from 501 to 516: score 3.9, E = 2
                   *->DdeLptltWqeVlqRi<-*
                      +d+L  l+W  V+q++
     B0252.2   501    MDDLSPLSWNKVIQKL    516



[DB home][top]