hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm1/seq/B0513.3
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  B0513.3  CE15559  locus:rpl-29 60S ribosomal protein L29 status:Confirmed TR:O45226 protein_id:CAB05115.1

Scores for sequence family classification (score includes all domains):
Model          Description                              Score    E-value  N
--------       -----------                              -----    ------- ---
Ribosomal_L29e Ribosomal L29e protein family             77.7    2.3e-21   1

Parsed for domains:
Model          Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------       ------- ----- -----    ----- -----      -----  -------
Ribosomal_L29e   1/1       3    42 ..     1    40 []    77.7  2.3e-21

Alignments of top-scoring domains:
Ribosomal_L29e: domain 1 of 1, from 3 to 42: score 77.7, E = 2.3e-21
                   *->ksKnHtnHnqnkKahRnGikkpkkkryeslkgvDaKflrn<-*
                      ksKnHtnHnqnkKahRnGi+kpkk+++ s+kgvDaKf++n
     B0513.3     3    KSKNHTNHNQNKKAHRNGITKPKKHIFLSMKGVDAKFIKN    42

[DB home][top]