hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm1/seq/C06A1.5
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  C06A1.5  CE02117   DNA directed RNA polymerase status:Partially_confirmed SW:Q17684 protein_id:CAA90053.1

Scores for sequence family classification (score includes all domains):
Model        Description                                Score    E-value  N
--------     -----------                                -----    ------- ---
RNA_pol_Rpb6 RNA polymerase Rpb6                         76.7    5.7e-20   1

Parsed for domains:
Model        Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------     ------- ----- -----    ----- -----      -----  -------
RNA_pol_Rpb6   1/1      64   117 ..     1    56 []    76.7  5.7e-20

Alignments of top-scoring domains:
RNA_pol_Rpb6: domain 1 of 1, from 64 to 117: score 76.7, E = 5.7e-20
                   *->kvlskYeLvriaakRArQlamgapePlvdtekisdkpvdIAlrEiaa
                      + ++kYe++r+++ RA+Q+amgap+ +v+ e+ +++p+ IA++E+++
     C06A1.5    64    PFMTKYERARVLGTRALQIAMGAPV-MVELEG-ETDPLEIARKELKQ 108

                   gkipitirr<-*
                   + ipi++rr
     C06A1.5   109 RRIPIIVRR    117

[DB home][top]