Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm1/seq/C06C6.5a
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  C06C6.5a  CE15599  locus:nhr-50 Zinc finger, C4 type (two domains) status:Partially_confirmed TR:O62031 protein_id:CAB07555.1

Scores for sequence family classification (score includes all domains):
Model       Description                                 Score    E-value  N
--------    -----------                                 -----    ------- ---
zf-C4       Zinc finger, C4 type (two domains)           37.9    4.6e-10   2
hormone_rec Ligand-binding domain of nuclear hormone     12.1     0.0094   1

Parsed for domains:
Model       Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------    ------- ----- -----    ----- -----      -----  -------
zf-C4         1/2      14    29 ..    14    29 ..    12.1    0.026
zf-C4         2/2      52    73 ..    56    77 .]    27.4  6.7e-07
hormone_rec   1/1     261   304 ..   101   145 ..    12.1   0.0094

Alignments of top-scoring domains:
zf-C4: domain 1 of 2, from 14 to 29: score 12.1, E = 0.026
                   *->HYGvlTCEGCKGFFrR<-*
                      H+G+l+C  C +FFrR
    C06C6.5a    14    HFGALSCRACAAFFRR    29

zf-C4: domain 2 of 2, from 52 to 73: score 27.4, E = 6.7e-07
                   *->CQyCRLkKCLeVGMskeaVrfg<-*
                      C+ CR kKCL++GM+ e V+++
    C06C6.5a    52    CRECRIKKCLSIGMNPEKVQEK    73

hormone_rec: domain 1 of 1, from 261 to 304: score 12.1, E = 0.0094
                   *->ldeeEyalLkAIvLfnPsdvpgLsesarelveklqekylsaLlqy<-
                      ld+ E+ +L  I+Lf+  ++ ++s ++ e ++ +++ + ++L++y
    C06C6.5a   261    LDQPEFMALALIILFDG-AYSNISVECSEMCRTIRNLIFRELKNY   304

                   *

    C06C6.5a     -   -



[DB home][top]