hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm1/seq/C11G6.3
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  C11G6.3  CE05257   PHD-finger. status:Partially_confirmed TR:Q17909 protein_id:CAA94113.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
PHD      PHD-finger                                      61.2    1.3e-18   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PHD        1/1     309   357 ..     1    51 []    61.2  1.3e-18

Alignments of top-scoring domains:
PHD: domain 1 of 1, from 309 to 357: score 61.2, E = 1.3e-18
                   *->yCsvCgkvdddaggdllqCDgCdrwfHlaClgppleeppegkWlCpe
                      +C+vC+  +   g ++++CD+C +wfH  C+g++ e p + kW+C +
     C11G6.3   309    ICPVCSVAYTV-GANMIGCDQCQDWFHWHCVGLTAE-PTDSKWFCTR 353

                   Ctpk<-*
                   Ct +
     C11G6.3   354 CTKG    357

[DB home][top]