Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm1/seq/C30G4.7
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  C30G4.7  CE27806    status:Confirmed TR:Q95ZX8 protein_id:AAK68211.1

Scores for sequence family classification (score includes all domains):
Model          Description                              Score    E-value  N
--------       -----------                              -----    ------- ---
TSC22          TSC-22/dip/bun family                     79.8    1.5e-24   1
LRR            Leucine Rich Repeat                        6.3        6.3   1
Pox_A_type_inc Viral A-type inclusion protein repeat      6.3        5.6   1

Parsed for domains:
Model          Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------       ------- ----- -----    ----- -----      -----  -------
Pox_A_type_inc   1/1      72    94 ..     1    23 []     6.3      5.6
LRR              1/1      87   111 ..     1    25 []     6.3      6.3
TSC22            1/1      59   114 .]     1    56 [.    79.8  1.5e-24

Alignments of top-scoring domains:
Pox_A_type_inc: domain 1 of 1, from 72 to 94: score 6.3, E = 5.6
                   *->rEldrlRrrIsdLekqLsdcrrn<-*
                      +E+d lR +I dLe+  ++ + +
     C30G4.7    72    EEVDGLRGKIFDLENHVRRLEAE    94

LRR: domain 1 of 1, from 87 to 111: score 6.3, E = 6.3
                   *->nLreLdLsgNnltgslppdafsgLt<-*
                      ++r+L+  ++ l+ ++p+d+++ L+
     C30G4.7    87    HVRRLEAENSILKRTIPNDTLKQLH    111

TSC22: domain 1 of 1, from 59 to 114: score 79.8, E = 1.5e-24
                   *->MDLVKsHLmyAVREEVEvLkeqIkeLveklnqLeeENtLLktnvSpE
                      MDLVK+HLm+AVREEV  L+ +I +L+  + +Le EN++Lk  ++
     C30G4.7    59    MDLVKTHLMFAVREEVDGLRGKIFDLENHVRRLEAENSILKRTIPND 105

                   qLaqlqaql<-*
                   +L ql + l
     C30G4.7   106 TLKQLHLKL    114



[DB home][top]