hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm2/seq/D1069.2
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  D1069.2  CE17614   calponin status:Partially_confirmed TR:O44788 protein_id:AAB94947.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
CH       Calponin homology (CH) domain                   62.3      8e-16   1
calponin Calponin family repeat                          36.0    1.4e-09   1
PAN      PAN domain                                       5.2        2.1   1
IL10     Interleukin 10                                   3.1        8.5   1
GSPII_E  Type II/IV secretion system protein              2.3        6.6   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
GSPII_E    1/1     132   141 ..   300   309 .]     2.3      6.6
PAN        1/1     178   188 ..    93   103 .]     5.2      2.1
CH         1/1      90   203 ..     1   106 []    62.3    8e-16
IL10       1/1     191   224 ..     1    35 [.     3.1      8.5
calponin   1/1     238   263 ..     1    26 []    36.0  1.4e-09

Alignments of top-scoring domains:
GSPII_E: domain 1 of 1, from 132 to 141: score 2.3, E = 6.6
                   *->RLVRkLCphC<-*
                      +L+ kL+p+C
     D1069.2   132    KLIEKLDPSC    141

PAN: domain 1 of 1, from 178 to 188: score 5.2, E = 2.1
                   *->qkvdyyenksC<-*
                      q+vd+yenk+C
     D1069.2   178    QTVDLYENKQC    188

CH: domain 1 of 1, from 90 to 203: score 62.3, E = 8e-16
                   *->sqekellrWinsvlagypgkkstlPippvpvtnfftdwlkDGlaLca
                      ++  e l+Wi++v+++++       +++++ + + + +lkDG+ Lc+
     D1069.2    90    EEAIEVLKWIENVTGERFSFD----VTTCESSTDVSNLLKDGVMLCK 132

                   Llnklr..................eNlnlaldaaekeGlgivlvlldpeD
                   L++kl ++ +   +++++   +  eN++++l aa++ G+ + +  ++++D
     D1069.2   133 LIEKLDpscrvvynkkpkmafpmmENISNFLAAAKQFGVME-ISCFQTVD 181

                   iveaegnpdPDeklvltylwqLirrfq<-*
                   ++e  +++   + +v+ +l  L+ ++q
     D1069.2   182 LYE--NKQ---CYKVIECLRLLAAVAQ    203

IL10: domain 1 of 1, from 191 to 224: score 3.1, E = 8.5
                   *->alLqCLvlLaGvaasrdeylasesscthlpvslph<-*
                       ++ CL lLa va sr   l   +  ++l++s p+
     D1069.2   191    -VIECLRLLAAVAQSRSSHLEHPAWVVKLAQSSPR    224

calponin: domain 1 of 1, from 238 to 263: score 36.0, E = 1.4e-09
                   *->iGLqmGtnKgAsqaGmtaYGtprrli<-*
                      i Lq GtnK Asq+Gm+ YG pr++
     D1069.2   238    IPLQYGTNKCASQKGMSPYGLPRQIK    263

[DB home][top]