Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm2/seq/F26E4.11
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  F26E4.11  CE09695   Zinc finger, C3HC4 type (RING finger) status:Confirmed SW:P90859 protein_id:CAB03009.1

Scores for sequence family classification (score includes all domains):
Model      Description                                  Score    E-value  N
--------   -----------                                  -----    ------- ---
CUE        CUE domain                                    54.6    1.4e-14   1
zf-C3HC4   Zinc finger, C3HC4 type (RING finger)         16.2    7.3e-05   1
Antistasin Antistasin family                              3.4        7.1   1

Parsed for domains:
Model      Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------   ------- ----- -----    ----- -----      -----  -------
zf-C3HC4     1/1     335   372 ..     1    50 []    16.2  7.3e-05
Antistasin   1/1     367   374 ..    20    30 .]     3.4      7.1
CUE          1/1     432   473 ..     1    43 []    54.6  1.4e-14

Alignments of top-scoring domains:
zf-C3HC4: domain 1 of 1, from 335 to 372: score 16.2, E = 7.3e-05
                   *->CrICleelkepsndfplilpCgHsGslkyfCrsClerWlsgnttvkC
                      C +C e l +        lpC H      f+  Cl+ Wl   ++  C
    F26E4.11   335    CVVCWELLGTSR-----RLPCSHQ-----FHDWCLMWWLAQDSS--C 369

                   plC<-*
                   p C
    F26E4.11   370 PTC    372

Antistasin: domain 1 of 1, from 367 to 374: score 3.4, E = 7.1
                   *->nGCpAiatCkC<-*
                      ++Cp   tC+C
    F26E4.11   367    SSCP---TCRC    374

CUE: domain 1 of 1, from 432 to 473: score 54.6, E = 1.4e-14
                   *->endealhqlkemFPqldeevIravLeantgnveatinnLLegs<-*
                      +++++l+q++emFPq+++ +I+ +L+ + g+ ++ti+n+Leg+
    F26E4.11   432    QLQTMLEQVREMFPQMSVDIIMTDLR-QSGSAQSTIENILEGR    473



[DB home][top]