Motif confirmation by HMMer
hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file: hmm2/seq/F26E4.11
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: F26E4.11 CE09695 Zinc finger, C3HC4 type (RING finger) status:Confirmed SW:P90859 protein_id:CAB03009.1
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
CUE CUE domain 54.6 1.4e-14 1
zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 16.2 7.3e-05 1
Antistasin Antistasin family 3.4 7.1 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
zf-C3HC4 1/1 335 372 .. 1 50 [] 16.2 7.3e-05
Antistasin 1/1 367 374 .. 20 30 .] 3.4 7.1
CUE 1/1 432 473 .. 1 43 [] 54.6 1.4e-14
Alignments of top-scoring domains:
zf-C3HC4: domain 1 of 1, from 335 to 372: score 16.2, E = 7.3e-05
*->CrICleelkepsndfplilpCgHsGslkyfCrsClerWlsgnttvkC
C +C e l + lpC H f+ Cl+ Wl ++ C
F26E4.11 335 CVVCWELLGTSR-----RLPCSHQ-----FHDWCLMWWLAQDSS--C 369
plC<-*
p C
F26E4.11 370 PTC 372
Antistasin: domain 1 of 1, from 367 to 374: score 3.4, E = 7.1
*->nGCpAiatCkC<-*
++Cp tC+C
F26E4.11 367 SSCP---TCRC 374
CUE: domain 1 of 1, from 432 to 473: score 54.6, E = 1.4e-14
*->endealhqlkemFPqldeevIravLeantgnveatinnLLegs<-*
+++++l+q++emFPq+++ +I+ +L+ + g+ ++ti+n+Leg+
F26E4.11 432 QLQTMLEQVREMFPQMSVDIIMTDLR-QSGSAQSTIENILEGR 473