hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm3/seq/F41G3.14
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  F41G3.14  CE28932    status:Partially_confirmed TR:Q95QG7 protein_id:AAK93855.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
RNase_PH 3' exoribonuclease family, domain 1             33.8    1.7e-08   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
RNase_PH   1/1     125   159 ..   119   153 .]    33.8  1.7e-08

Alignments of top-scoring domains:
RNase_PH: domain 1 of 1, from 125 to 159: score 33.8, E = 1.7e-08
                   *->ewqirvdvevLesdGstsdaainAaslALadAgiP<-*
                      ewq+ ++v vL+ +G+ +daa++A  +AL+dA++P
    F41G3.14   125    EWQLHIIVKVLSLEGNFLDAAVCALGAALVDAKLP    159

[DB home][top]