Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm3/seq/F47B7.1
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  F47B7.1  CE02743    status:Confirmed SW:Q20516 protein_id:AAA80373.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
UPF0057  Uncharacterized protein family UPF0057         107.4    2.7e-28   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
UPF0057    1/1       6    57 ..     1    52 []   107.4  2.7e-28

Alignments of top-scoring domains:
UPF0057: domain 1 of 1, from 6 to 57: score 107.4, E = 2.7e-28
                   *->ddiieiILaifLPPlAVfLhkgeCgkhvlInILLtiLgyiPGiIHAl
                      ++iie+ILaifLPPlA+f+h+++C++hv++nI+L++++++P++IHAl
     F47B7.1     6    QQIIELILAIFLPPLAIFIHGNDCNMHVAVNIILCFFFFVPAVIHAL 52

                   yvcff<-*
                   ++cff
     F47B7.1    53 WYCFF    57



[DB home][top]