Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm3/seq/F54F3.3
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  F54F3.3  CE18732   lipase status:Partially_confirmed TR:Q93789 protein_id:CAB01973.1

Scores for sequence family classification (score includes all domains):
Model          Description                              Score    E-value  N
--------       -----------                              -----    ------- ---
abhydro_lipase ab-hydrolase associated lipase region    161.2    1.1e-44   1
abhydrolase    alpha/beta hydrolase fold                 30.3    2.7e-08   1
ATP-synt_8     ATP synthase protein 8                     4.6          2   1

Parsed for domains:
Model          Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------       ------- ----- -----    ----- -----      -----  -------
abhydro_lipase   1/1      23    94 ..     1    71 []   161.2  1.1e-44
ATP-synt_8       1/1     125   140 ..    41    56 .]     4.6        2
abhydrolase      1/1     108   176 ..     1    57 [.    30.3  2.7e-08

Alignments of top-scoring domains:
abhydro_lipase: domain 1 of 1, from 23 to 94: score 161.2, E = 1.1e-44
                   *->idpeanmnvsqlIkkwGYpsEeHtVtTeDGYILtLhRIprgkknktd
                       dpe  m+++q+I++wGYp++++ VtTeDGYIL+LhRIp+gk+n+t+
     F54F3.3    23    ADPEMKMTTPQIIMRWGYPAMIYDVTTEDGYILELHRIPYGKTNVTW 69

                   .lgkrPvVlLQHGLlasSsnWVvNl<-*
                   ++gk+PvV++QHGL +sSsnWVvNl
     F54F3.3    70 pNGKKPVVFMQHGLECSSSNWVVNL    94

ATP-synt_8: domain 1 of 1, from 125 to 140: score 4.6, E = 2
                   *->ktklkkkpnpWnWkWT<-*
                      k+ +++++ +W+W W
     F54F3.3   125    KNLKPSHSAFWDWSWD    140

abhydrolase: domain 1 of 1, from 108 to 176: score 30.3, E = 2.7e-08
                   *->frvillDlrGfGeSsp.............sdlaeyrfddlaedleal
                      ++v+l++ rG  +S ++++ +++++   +  ++e    dl +++e+
     F54F3.3   108    YDVWLGNFRGNTYSMKhknlkpshsafwdWSWDEMQQYDLPAMIEKA 154

                   ldalglekpvilvGhSmGGaial<-*
                   l+ +g++  ++++GhS+G+++++
     F54F3.3   155 LEVTGQDS-LYYIGHSQGTLTMF    176



[DB home][top]