Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm3/seq/F58A4.7a
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  F58A4.7a  CE01018   AP-4 status:Confirmed SW:P34474 protein_id:CAA80167.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
HLH      Helix-loop-helix DNA-binding domain             64.0    1.1e-15   1
SBP      SBP domain                                       5.0        3.9   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SBP        1/1      62    78 ..    63    79 .]     5.0      3.9
HLH        1/1      62   113 ..     1    53 []    64.0  1.1e-15

Alignments of top-scoring domains:
SBP: domain 1 of 1, from 62 to 78: score 5.0, E = 3.9
                   *->RrRLagHNeRRRKsspe<-*
                      Rr+ a+ NeRRR +s +
    F58A4.7a    62    RRQIANCNERRRMQSIN    78

HLH: domain 1 of 1, from 62 to 113: score 64.0, E = 1.1e-15
                   *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve
                      rR+ +n+ ERrR+++iN +f +Lr llP   +++KlsKa+iL+++ +
    F58A4.7a    62    RRQIANCNERRRMQSINAGFLALRALLPR-KEGEKLSKAAILQQTAD 107

                   YIksLq<-*
                    +++L
    F58A4.7a   108 MVHQLL    113



[DB home][top]