Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm3/seq/H37A05.1
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  H37A05.1  CE19946    status:Partially_confirmed TR:Q9XXT5 protein_id:CAA16154.1

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
lipin_N         lipin, N-terminal conserved region      256.5    3.7e-73   1
e3_binding      e3 binding domain                         7.8        3.1   1
acid_phosphat_B Acid phosphatase (Class B)                2.9        9.6   1
AFOR_C          Aldehyde ferredoxin oxidoreductase, d     1.2        8.4   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
lipin_N           1/1       1   107 [.     1   115 []   256.5  3.7e-73
AFOR_C            1/1     512   521 ..   469   478 .]     1.2      8.4
e3_binding        1/1     561   573 ..    30    42 .]     7.8      3.1
acid_phosphat_B   1/1     588   606 ..   135   153 ..     2.9      9.6

Alignments of top-scoring domains:
lipin_N: domain 1 of 1, from 1 to 107: score 256.5, E = 3.7e-73
                   *->MnyVGrlagrvfkgVkelynsiNpATLSGAIDVIVVeQpDGsfkcSP
                      M+y    a+rvfk+Vk++ynsiNpATLSGAIDV+VVeQp+G++k++P
    H37A05.1     1    MDY----AYRVFKNVKYFYNSINPATLSGAIDVVVVEQPNGEYKSTP 43

                   FHVRFGKfQGVLksseKvVdIevNGvevDlhMKLgDsGeAFFVeEvedqv
                   FHVRFGK+ GV+++s+K+VdI+vNGve+Dl+MKL+DsG+AFFVeE++dq
    H37A05.1    44 FHVRFGKY-GVFSYSDKYVDIAVNGVEIDLKMKLADSGVAFFVEEADDQ- 91

                   eevPdeLaTSPipsetts<-*
                     vPd+L+TSP+p+++t+
    H37A05.1    92 --VPDYLLTSPLPEQETP    107

AFOR_C: domain 1 of 1, from 512 to 521: score 1.2, E = 8.4
                   *->tkEtLeeLGL<-*
                      ++E+L+ LGL
    H37A05.1   512    SSEKLKSLGL    521

e3_binding: domain 1 of 1, from 561 to 573: score 7.8, E = 3.1
                   *->gGRItKeDVeaal<-*
                      +G ItK DV+ ++
    H37A05.1   561    DGTITKSDVLGHV    573

acid_phosphat_B: domain 1 of 1, from 588 to 606: score 2.9, E = 9.6
                   *->elynyllelGvkIffisgR<-*
                      ely  ++++G+k++++s R
    H37A05.1   588    ELYTRIKNNGYKMVYLSSR    606



[DB home][top]