Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm4/seq/M57.2
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  M57.2  CE19541    status:Partially_confirmed TR:Q9TYY0 protein_id:AAC68985.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
PPTA     Protein prenyltransferase alpha subunit repe    83.2    1.7e-22   5
LRR      Leucine Rich Repeat                             10.7       0.36   1
TPR      TPR Domain                                       5.9        7.3   2
DUF233   Odorant binding protein                          4.0          9   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PPTA       1/5      49    77 ..     3    31 .]     3.6       28
PPTA       2/5     114   135 ..     8    29 ..    10.5     0.27
TPR        1/2     123   136 ..     1    14 [.     1.5  1.3e+02
PPTA       3/5     143   173 ..     1    31 []    31.2  2.6e-07
PPTA       4/5     178   208 ..     1    31 []    34.2  3.3e-08
PPTA       5/5     225   252 ..     1    28 [.    15.3    0.011
DUF233     1/1     234   261 ..    26    55 ..     4.0        9
TPR        2/2     377   390 ..    21    34 .]     4.0       25
LRR        1/1     500   521 ..     1    25 []    10.7     0.36

Alignments of top-scoring domains:
PPTA: domain 1 of 5, from 49 to 77: score 3.6, E = 28
                   *->LeftselielnpkNYsaWnyRrwvleklg<-*
                      L +t+ ++e+n+  Y+ Wn Rr  +e
       M57.2    49    LSLTQAILEKNADIYTFWNIRRTTIELRM    77

PPTA: domain 2 of 5, from 114 to 135: score 10.5, E = 0.27
                   *->elielnpkNYsaWnyRrwvlek<-*
                      e+i+ npk YsaW +R w l++
       M57.2   114    ECIKSNPKSYSAWYQRAWALQR    135

TPR: domain 1 of 2, from 123 to 136: score 1.5, E = 1.3e+02
                   *->aeayynlGnaylkl<-*
                      + a+y++++a++++
       M57.2   123    YSAWYQRAWALQRQ    136

PPTA: domain 3 of 5, from 143 to 173: score 31.2, E = 2.6e-07
                   *->rELeftselielnpkNYsaWnyRrwvleklg<-*
                      +EL++++++++l+ +N+++W +Rr v + ++
       M57.2   143    KELALCEKALQLDCRNFHCWDHRRIVARMAK    173

PPTA: domain 4 of 5, from 178 to 208: score 34.2, E = 3.3e-08
                   *->rELeftselielnpkNYsaWnyRrwvleklg<-*
                      +ELef ++li +n++NYsaW+yR   l++++
       M57.2   178    EELEFSNKLINDNFSNYSAWHYRSIALKNIH    208

PPTA: domain 5 of 5, from 225 to 252: score 15.3, E = 0.011
                   *->rELeftselielnpkNYsaWnyRrwvle<-*
                      +EL+ ++ ++  +++ +saW y rw+le
       M57.2   225    SELQKVKNAFFMDAEDQSAWTYTRWLLE    252

DUF233: domain 1 of 1, from 234 to 261: score 4.0, E = 9
                   *->anitlenyvkarlrikgeveerpdGktYLk<-*
                      ++++ e+ + a+++++  +e++ +Gk++L+
       M57.2   234    FFMDAED-QSAWTYTRWLLEVG-SGKEFLR    261

TPR: domain 2 of 2, from 377 to 390: score 4.0, E = 25
                   *->ieayekALeldPnn<-*
                      +e++++ +el+P+n
       M57.2   377    LEDCKQLIELEPKN    390

LRR: domain 1 of 1, from 500 to 521: score 10.7, E = 0.36
                   *->nLreLdLsgNnltgslppdafsgLt<-*
                      nL++L ++ N+++ slpp     L+
       M57.2   500    NLKSLTINENPIE-SLPP--SPCLS    521



[DB home][top]