hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm4/seq/R07B1.1
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  R07B1.1  CE01626  locus:vab-15 homeobox protein (msh subfamily) status:Confirmed SW:Q09604 protein_id:CAA88539.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
homeobox Homeobox domain                                105.3    1.2e-27   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
homeobox   1/1     130   186 ..     1    57 []   105.3  1.2e-27

Alignments of top-scoring domains:
homeobox: domain 1 of 1, from 130 to 186: score 105.3, E = 1.2e-27
                   *->RrkRTtFtpeQleeLEkeFqknpYPsreeReeLAkkLgLterqVkvW
                      R++RT+F+++Ql  LE++Fq  +Y+s++eR+e + +L+Lte+qVk+W
     R07B1.1   130    RKPRTPFSTQQLISLERKFQSKQYLSIAERAEFSASLQLTETQVKIW 176

                   FQNRRaKwKk<-*
                   FQNRRaK K+
     R07B1.1   177 FQNRRAKSKR    186

[DB home][top]