Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm4/seq/T04C10.4
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  T04C10.4  CE06355   transcription factor ATF4 like status:Confirmed TR:Q22156 protein_id:CAA93757.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
bZIP     bZIP transcription factor                       33.3    5.9e-08   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
bZIP       1/1     136   200 ..     1    65 []    33.3  5.9e-08

Alignments of top-scoring domains:
bZIP: domain 1 of 1, from 136 to 200: score 33.3, E = 5.9e-08
                   *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk
                      + + K+er+k++NR+AA+r+R++K+ e ee  + +e L+  N +L++
    T04C10.4   136    KTPEKKERKKAQNRLAATRYREKKRREKEEAMTCIEGLSVTNGKLKD 182

                   elerLkkevakLksenee<-*
                    +++L+ e+ + k+  +e
    T04C10.4   183 QVSELEREIRYFKKFMTE    200



[DB home][top]