hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm4/seq/T05H10.5a
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  T05H10.5a  CE01642    status:Partially_confirmed SW:Q09349 protein_id:CAA87792.1

Scores for sequence family classification (score includes all domains):
Model          Description                              Score    E-value  N
--------       -----------                              -----    ------- ---
U-box          U-box domain                             156.5    4.9e-53   1
Pox_A_type_inc Viral A-type inclusion protein repeat      8.0        1.6   1
FTCD_C         Formiminotransferase-cyclodeaminase        6.0        2.1   1
DUF259         Protein of unknown function, DUF259        3.1        4.1   1
FHIPEP         FHIPEP family                              1.5          7   1

Parsed for domains:
Model          Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------       ------- ----- -----    ----- -----      -----  -------
DUF259           1/1     324   335 ..     1    12 [.     3.1      4.1
Pox_A_type_inc   1/1     468   486 ..     1    19 [.     8.0      1.6
FTCD_C           1/1     878   897 ..   200   219 .]     6.0      2.1
FHIPEP           1/1     953   964 ..   677   688 .]     1.5        7
U-box            1/1     905   978 ..     1    81 []   156.5  4.9e-53

Alignments of top-scoring domains:
DUF259: domain 1 of 1, from 324 to 335: score 3.1, E = 4.1
                   *->adamRamLDqLM<-*
                      +d +R mL qLM
   T05H10.5a   324    MDPIRTMLHQLM    335

Pox_A_type_inc: domain 1 of 1, from 468 to 486: score 8.0, E = 1.6
                   *->rEldrlRrrIsdLekqLsd<-*
                      r+l++l+ +I+ L+++L++
   T05H10.5a   468    RHLKELKHKINALKEKLNT    486

FTCD_C: domain 1 of 1, from 878 to 897: score 6.0, E = 2.1
                   *->flenqeelaerikkklediv<-*
                      +le  e+lae++kk  e+++
   T05H10.5a   878    QLESFEHLAEDVKKEYEAKA    897

FHIPEP: domain 1 of 1, from 953 to 964: score 1.5, E = 7
                   *->LSyqElpeeikI<-*
                      LS++El++++++
   T05H10.5a   953    LSHNELSPDSEL    964

U-box: domain 1 of 1, from 905 to 978: score 156.5, E = 4.9e-53
                   *->DiPDEFlDPItleLMkDPVilPSGkityDRstIerHLlsEAWGvdpt
                      D+P+EF+DPI++ +M+DPV lPSG +++DR+ IerHLls     +p+
   T05H10.5a   905    DVPEEFKDPIMDAIMVDPVKLPSG-HVMDRAVIERHLLS-----TPN 945

                   DPftGRepLthdeliPNleLKekIdafleekrea<-*
                   +Pf+ R+pL h+el P+ eLK+kI++++++kr++
   T05H10.5a   946 NPFN-RAPLSHNELSPDSELKAKIQEWICQKRNS    978

[DB home][top]