Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm4/seq/T06D8.2
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  T06D8.2  CE21155    status:Partially_confirmed TR:Q22249 protein_id:CAA88965.1

Scores for sequence family classification (score includes all domains):
Model          Description                              Score    E-value  N
--------       -----------                              -----    ------- ---
UVR            UvrB/uvrC motif                           43.3    3.3e-11   2
Chorismate_mut Chorismate mutase                          5.1        6.2   1
TFIID-18       Transcription initiation factor IID, 1     4.5        5.5   1
UPF0171        Uncharacterised protein family (UPF017     1.0        8.8   1

Parsed for domains:
Model          Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------       ------- ----- -----    ----- -----      -----  -------
TFIID-18         1/1     161   170 ..     1    10 [.     4.5      5.5
UVR              1/2     168   203 ..     1    36 []     6.0      4.3
UVR              2/2     204   239 ..     1    36 []    43.7  2.5e-11
Chorismate_mut   1/1     429   447 ..     1    19 [.     5.1      6.2
UPF0171          1/1     471   485 ..   648   662 .]     1.0      8.8

Alignments of top-scoring domains:
TFIID-18: domain 1 of 1, from 161 to 170: score 4.5, E = 5.5
                   *->hlFrkeLqsM<-*
                      h+++keLq M
     T06D8.2   161    HKYSKELQAM    170

UVR: domain 1 of 2, from 168 to 203: score 6.0, E = 4.3
                   *->ekeikeLekeMeeAaenldFEkAAeLRDeIqaLkeq<-*
                      +++i ++e+ ++ A++n+dF +A +    +++Lk+
     T06D8.2   168    QAMIGAIERNKQTAVANEDFKLAKSAQLAVRDLKKS    203

UVR: domain 2 of 2, from 204 to 239: score 43.7, E = 2.5e-11
                   *->ekeikeLekeMeeAaenldFEkAAeLRDeIqaLkeq<-*
                       ke++eLe+++ eA++++dF++A  L DeI+aL+++
     T06D8.2   204    TKEMEELENDKGEAVADEDFQRANDLQDEITALRSN    239

Chorismate_mut: domain 1 of 1, from 429 to 447: score 5.1, E = 6.2
                   *->lsekapgeledlRakidel<-*
                        e+++++ e++R+kid+l
     T06D8.2   429    HFENRKEGIEEIREKIDSL    447

UPF0171: domain 1 of 1, from 471 to 485: score 1.0, E = 8.8
                   *->lldkFrdVlvvfese<-*
                      l+  ++dVl+ +++
     T06D8.2   471    LFTVYKDVLLLWHHF    485



[DB home][top]