Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm4/seq/T10E9.7
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  T10E9.7  CE13555   NADH-ubiquinone oxidoredutase 30 kd subunit status:Partially_confirmed TR:O01602 protein_id:AAB52474.1

Scores for sequence family classification (score includes all domains):
Model         Description                               Score    E-value  N
--------      -----------                               -----    ------- ---
complex1_30Kd Respiratory-chain NADH dehydrogenase, 3   160.2    2.8e-46   1
KH            KH domain                                  35.6    1.1e-08   1
DUF496        Protein of unknown function (DUF496)        7.7       0.94   1
RBFA          Ribosome-binding factor A                   4.5        9.4   1

Parsed for domains:
Model         Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------      ------- ----- -----    ----- -----      -----  -------
DUF496          1/1      66    81 ..     1    16 [.     7.7     0.94
KH              1/1      84   129 ..     1    49 []    35.6  1.1e-08
RBFA            1/1     131   149 ..     1    19 [.     4.5      9.4
complex1_30Kd   1/1     273   340 ..     1    73 []   160.2  2.8e-46

Alignments of top-scoring domains:
DUF496: domain 1 of 1, from 66 to 81: score 7.7, E = 0.94
                   *->fqdVLEfVrlfRrKNk<-*
                      ++dVLE V+  R KN+
     T10E9.7    66    LNDVLELVSTIRNKNQ    81

KH: domain 1 of 1, from 84 to 129: score 35.6, E = 1.1e-08
                   *->evlvpasrvGliIGkgGsnIkeireetgakIdipddsegsverivti
                      +++ p + +G++IGk+G+ I+ei+  +++ +++++    +++r++ +
     T10E9.7    84    KFEMPSKDIGFLIGKNGAKINEIKLSSNVDVHFERN---NENRDNGE 127

                   tg<-*
                   t+
     T10E9.7   128 TD    129

RBFA: domain 1 of 1, from 131 to 149: score 4.5, E = 9.4
                   *->RarRlaseIqaeiaqiLqr<-*
                      R+++l+s I+++++  ++r
     T10E9.7   131    RVKMLGSVIRQAVSRQIVR    149

complex1_30Kd: domain 1 of 1, from 273 to 340: score 160.2, E = 2.8e-46
                   *->vkvfvpeddppevpSvtsifpaAnWyEREvyDMFGIfFegHPdLRRI
                      v+++++e++p  ++S+t++f++A+W+EREvyDM+G+ F++HPdLRRI
     T10E9.7   273    VRTYTDEIAP--IDSATPVFKGADWFEREVYDMYGVWFNNHPDLRRI 317

                   LtdygfpeeeGhPLRKDFPltgyvev<-*
                   Ltdygf   eGhP+RKD+Pl+gy+ev
     T10E9.7   318 LTDYGF---EGHPFRKDYPLSGYNEV    340



[DB home][top]