hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm4/seq/T23G7.3
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  T23G7.3  CE03704    status:Confirmed TR:Q22705 protein_id:CAA92701.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
G-patch  G-patch domain                                  58.2    1.9e-15   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
G-patch    1/1      26    70 ..     1    45 []    58.2  1.9e-15

Alignments of top-scoring domains:
G-patch: domain 1 of 1, from 26 to 70: score 58.2, E = 1.9e-15
                   *->tsniGfklLqKMGWkeGqGLGkneqGivePieakikkdraGLGae<-
                           +kl++KMGW+eG GLG+n qG+++ ++ k ++ ++GLGa+
     T23G7.3    26    DQKLSKKLMEKMGWSEGDGLGRNRQGNADSVKLKANTSGRGLGAD   70

                   *

     T23G7.3     -   -

[DB home][top]