Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm4/seq/T27E9.2
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  T27E9.2  CE14265   ubiquinol-cytochrome c reductase complexn 11 KD protein status:Confirmed TR:O45864 protein_id:CAB04873.1

Scores for sequence family classification (score includes all domains):
Model     Description                                   Score    E-value  N
--------  -----------                                   -----    ------- ---
UCR_hinge Ubiquinol-cytochrome C reductase hinge prot   156.8    7.5e-45   1

Parsed for domains:
Model     Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------  ------- ----- -----    ----- -----      -----  -------
UCR_hinge   1/1      13    75 .]     1    65 []   156.8  7.5e-45

Alignments of top-scoring domains:
UCR_hinge: domain 1 of 1, from 13 to 75: score 156.8, E = 7.5e-45
                   *->VDplttlrerCkqLekcvkakkeleaCdeRveSrssteedCteelfD
                      VD+lt++rerC+  ++++++k++l++C++Rv+Srs+tee+C++e++D
     T27E9.2    13    VDQLTQYRERCA--DHVTEFKSILDECNDRVNSRSNTEETCHQEMAD 57

                   YlHalDhCvaaKlFdsLK<-*
                   Y+H+lDhC+++K+F+sLK
     T27E9.2    58 YVHHLDHCAMPKAFASLK    75



[DB home][top]