Motif confirmation by HMMer
hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file: hmm4/seq/W05E10.3
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: W05E10.3 CE29364 locus:ceh-32 homeobox protein (so subfamily) status:Confirmed SW:Q23175 protein_id:CAB01249.2
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
homeobox Homeobox domain 43.9 3.1e-09 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
homeobox 1/1 204 242 .. 19 57 .] 43.9 3.1e-09
Alignments of top-scoring domains:
homeobox: domain 1 of 1, from 204 to 242: score 43.9, E = 3.1e-09
*->FqknpYPsreeReeLAkkLgLterqVkvWFQNRRaKwKk<-*
+ k+pYP++++++eLA+ +gLt qV +WF NRR++ +
W05E10.3 204 YLKDPYPNPPKKKELANATGLTQMQVGNWFKNRRQRDRA 242