Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm5/seq/Y37A1B.1
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  Y37A1B.1  CE19070    status:Partially_confirmed TR:Q9XTH8 protein_id:CAB05201.1

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
SAP             SAP domain                               49.8    1.6e-12   1
Lysine_decarbox Lysine decarboxylase family               8.7       0.18   1
ATP-synt_ab_C   ATP synthase alpha/beta chain, C term     3.6        8.9   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Lysine_decarbox   1/1      45    66 ..     1    30 [.     8.7     0.18
SAP               1/1     660   694 ..     1    35 []    49.8  1.6e-12
ATP-synt_ab_C     1/1    1072  1116 ..    97   147 .]     3.6      8.9

Alignments of top-scoring domains:
Lysine_decarbox: domain 1 of 1, from 45 to 66: score 8.7, E = 0.18
                   *->MgavadGAlieaGgrikdrviGiiPnillp<-*
                      Mg+v+++A+  ++g     v+G+   ++++
    Y37A1B.1    45    MGMVNQAAF-SSQG-----VLGM--QGIMG    66

SAP: domain 1 of 1, from 660 to 694: score 49.8, E = 1.6e-12
                   *->lskLkVseLKeeLkkrGLstsGkKaeLieRLleal<-*
                       +++kV+eL+ eL+ rGL+t+G K+ L++RL++al
    Y37A1B.1   660    PKSMKVAELRVELELRGLETKGIKTLLVQRLQTAL    694

ATP-synt_ab_C: domain 1 of 1, from 1072 to 1116: score 3.6, E = 8.9
                   *->veetidlfyallrGklddlpedalekigtidiakykalnkellekak
                      v+e++ l+++l        ++++++k +++++ +y+++nk+l e+
    Y37A1B.1  1072    VSEQLSLIEQLRE------AKAEIDKKKKDIDSHYHKSNKKLNETSA 1112

                   kllk<-*
                   +l++
    Y37A1B.1  1113 QLKS    1116



[DB home][top]