Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm5/seq/Y47H9C.2
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  Y47H9C.2  CE20263    status:Partially_confirmed TR:Q9XWD7 protein_id:CAA21738.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
zf-DHHC  DHHC zinc finger domain                        114.3    5.4e-31   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
zf-DHHC    1/1     155   219 ..     1    66 []   114.3  5.4e-31

Alignments of top-scoring domains:
zf-DHHC: domain 1 of 1, from 155 to 219: score 114.3, E = 5.4e-31
                   *->ldngkfgeikfCskCnsyKVPpRShHCsvCnkCVlrmDHHCpWinnC
                      ++ng + + k+C++C+ y+ PpR++HC  C+ CVl++DHHCpW++nC
    Y47H9C.2   155    VVNGEHVKMKYCTTCRLYR-PPRCSHCAICDNCVLMFDHHCPWVGNC 200

                   VGlrNykyFllFlaylsll<-*
                   +GlrNy yF++F+++ls+l
    Y47H9C.2   201 IGLRNYTYFYRFVFCLSIL    219



[DB home][top]