Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm5/seq/Y53C12B.5
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  Y53C12B.5  CE14902  locus:mab-3 DM DNA binding domain status:Partially_confirmed SW:O18214 protein_id:CAB16489.1

Scores for sequence family classification (score includes all domains):
Model         Description                               Score    E-value  N
--------      -----------                               -----    ------- ---
DM-domain     DM DNA binding domain                     189.6      5e-53   2
LytR_cpsA_psr Cell envelope-related transcriptional a     4.9       0.54   1
PHD           PHD-finger                                  4.7        2.6   1

Parsed for domains:
Model         Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------      ------- ----- -----    ----- -----      -----  -------
PHD             1/1      20    34 ..    37    51 .]     4.7      2.6
DM-domain       1/2      24    70 ..     1    48 []    96.6  2.3e-25
DM-domain       2/2      90   137 ..     1    48 []   101.0  1.4e-26
LytR_cpsA_psr   1/1     239   252 ..   178   191 .]     4.9     0.54

Alignments of top-scoring domains:
PHD: domain 1 of 1, from 20 to 34: score 4.7, E = 2.6
                   *->eppegkWlCpeCtpk<-*
                      +++e +++C +C ++
   Y53C12B.5    20    AEQEKNYYCQRCLNH    34

DM-domain: domain 1 of 2, from 24 to 70: score 96.6, E = 2.3e-25
                   *->RipyCqRCenHGekvpLKGHKryCpfrdCtCkkvCtlvekRRrlmal
                      +++yCqRC+nHGe++p+KGHK++C++++C+C++ Ct+ve+RR+l++l
   Y53C12B.5    24    KNYYCQRCLNHGELKPRKGHKPDCRYLKCPCRE-CTMVEQRRQLNNL 69

                   q<-*
                   +
   Y53C12B.5    70 L    70

DM-domain: domain 2 of 2, from 90 to 137: score 101.0, E = 1.4e-26
                   *->RipyCqRCenHGekvpLKGHKr.yCpfrdCtCkkvCtlvekRRrlma
                      R+p+C+RC++HG++vpL+GHKr++C+f++C+C+  Ctlve+RR+lma
   Y53C12B.5    90    RDPHCARCSAHGVLVPLRGHKRtMCQFVTCECTL-CTLVEHRRNLMA 135

                   lq<-*
                   +q
   Y53C12B.5   136 AQ    137

LytR_cpsA_psr: domain 1 of 1, from 239 to 252: score 4.9, E = 0.54
                   *->QqqvlkAlikklks<-*
                      Qqq+l+++i+ ++
   Y53C12B.5   239    QQQFLMSIIQNMAP    252



[DB home][top]