Motif confirmation by HMMer
hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file: hmm5c/seq/ZK863.6
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: ZK863.6 CE15445 locus:dpy-30 DPY-30 protein status:Confirmed SW:Q10661 protein_id:CAB01452.1
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
Dpy-30 Dpy-30 motif 79.7 3.3e-20 1
B1 Protein L b1 domain 3.7 3.5 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
B1 1/1 33 56 .. 1 25 [. 3.7 3.5
Dpy-30 1/1 69 110 .. 1 42 [] 79.7 3.3e-20
Alignments of top-scoring domains:
B1: domain 1 of 1, from 33 to 56: score 3.7, E = 3.5
*->tPEedskEevtiKanlifadGstqt<-*
E +s+E+ t+ n++ a+G qt
ZK863.6 33 -AEAESNENTTVPSNVLSANGGQQT 56
Dpy-30: domain 1 of 1, from 69 to 110: score 79.7, E = 3.3e-20
*->paRqYLnqtVaPiLlqGLtelAkeRPeDPiefLAeyLlknnn<-*
p+RqYL+ tV+PiLlqGL +lAk+RPe+PiefLA++Ll +
ZK863.6 69 PTRQYLDSTVVPILLQGLGALAKDRPENPIEFLANFLLREKD 110